Cargando…
A new xyelotomid (Hymenoptera) from the Middle Jurassic of China displaying enigmatic venational asymmetry
BACKGROUND: Pterygota insects typically have symmetric veins in left and right wings. For studying taxonomy and phylogeny of fossil insects, venational patterns are commonly used as diagnostic characters, in conjunction with preserved body characters. Some examples of asymmetrical venation are known...
Autores principales: | , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2016
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4971703/ https://www.ncbi.nlm.nih.gov/pubmed/27485108 http://dx.doi.org/10.1186/s12862-016-0730-0 |
_version_ | 1782446153308045312 |
---|---|
author | Gao, Taiping Shih, Chungkun Engel, Michael S. Ren, Dong |
author_facet | Gao, Taiping Shih, Chungkun Engel, Michael S. Ren, Dong |
author_sort | Gao, Taiping |
collection | PubMed |
description | BACKGROUND: Pterygota insects typically have symmetric veins in left and right wings. For studying taxonomy and phylogeny of fossil insects, venational patterns are commonly used as diagnostic characters, in conjunction with preserved body characters. Some examples of asymmetrical venation are known among extant insects, but only a few fossil insects with asymmetric wings have been reported, among which a previously described xyelotomid of Hymenoptera, Xyelocerus diaphanous, displays an unusual, small cell of vein Rs in the left forewing, but not in the right. RESULTS: Herein we report a new sawfly of the family Xyelotomidae, Aethotoma aninomorpha gen. et sp. nov., from the late Middle Jurassic of China having a simple Sc in the forewing and Sc with two branches in the hind wing. In additional, the new specimen exhibits an enigmatic venational asymmetry. In the right forewing, crossvein 2r-rs of forms a loop, then forks into 2 long branches reaching Rs, while 2r-rs of the left forewing forks into 2 short branches reaching Rs, in contrast to a linear 2r-rs in typical fossil and extant sawflies. CONCLUSION: Such rare asymmetrical venation found from fossil sawflies provides a glance at early occurrences of venational variability and instability, or possibly aberrational development, for insects in the late Middle Jurassic. |
format | Online Article Text |
id | pubmed-4971703 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2016 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-49717032016-08-04 A new xyelotomid (Hymenoptera) from the Middle Jurassic of China displaying enigmatic venational asymmetry Gao, Taiping Shih, Chungkun Engel, Michael S. Ren, Dong BMC Evol Biol Research Article BACKGROUND: Pterygota insects typically have symmetric veins in left and right wings. For studying taxonomy and phylogeny of fossil insects, venational patterns are commonly used as diagnostic characters, in conjunction with preserved body characters. Some examples of asymmetrical venation are known among extant insects, but only a few fossil insects with asymmetric wings have been reported, among which a previously described xyelotomid of Hymenoptera, Xyelocerus diaphanous, displays an unusual, small cell of vein Rs in the left forewing, but not in the right. RESULTS: Herein we report a new sawfly of the family Xyelotomidae, Aethotoma aninomorpha gen. et sp. nov., from the late Middle Jurassic of China having a simple Sc in the forewing and Sc with two branches in the hind wing. In additional, the new specimen exhibits an enigmatic venational asymmetry. In the right forewing, crossvein 2r-rs of forms a loop, then forks into 2 long branches reaching Rs, while 2r-rs of the left forewing forks into 2 short branches reaching Rs, in contrast to a linear 2r-rs in typical fossil and extant sawflies. CONCLUSION: Such rare asymmetrical venation found from fossil sawflies provides a glance at early occurrences of venational variability and instability, or possibly aberrational development, for insects in the late Middle Jurassic. BioMed Central 2016-08-02 /pmc/articles/PMC4971703/ /pubmed/27485108 http://dx.doi.org/10.1186/s12862-016-0730-0 Text en © The Author(s). 2016 Open AccessThis article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated. |
spellingShingle | Research Article Gao, Taiping Shih, Chungkun Engel, Michael S. Ren, Dong A new xyelotomid (Hymenoptera) from the Middle Jurassic of China displaying enigmatic venational asymmetry |
title | A new xyelotomid (Hymenoptera) from the Middle Jurassic of China displaying enigmatic venational asymmetry |
title_full | A new xyelotomid (Hymenoptera) from the Middle Jurassic of China displaying enigmatic venational asymmetry |
title_fullStr | A new xyelotomid (Hymenoptera) from the Middle Jurassic of China displaying enigmatic venational asymmetry |
title_full_unstemmed | A new xyelotomid (Hymenoptera) from the Middle Jurassic of China displaying enigmatic venational asymmetry |
title_short | A new xyelotomid (Hymenoptera) from the Middle Jurassic of China displaying enigmatic venational asymmetry |
title_sort | new xyelotomid (hymenoptera) from the middle jurassic of china displaying enigmatic venational asymmetry |
topic | Research Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4971703/ https://www.ncbi.nlm.nih.gov/pubmed/27485108 http://dx.doi.org/10.1186/s12862-016-0730-0 |
work_keys_str_mv | AT gaotaiping anewxyelotomidhymenopterafromthemiddlejurassicofchinadisplayingenigmaticvenationalasymmetry AT shihchungkun anewxyelotomidhymenopterafromthemiddlejurassicofchinadisplayingenigmaticvenationalasymmetry AT engelmichaels anewxyelotomidhymenopterafromthemiddlejurassicofchinadisplayingenigmaticvenationalasymmetry AT rendong anewxyelotomidhymenopterafromthemiddlejurassicofchinadisplayingenigmaticvenationalasymmetry AT gaotaiping newxyelotomidhymenopterafromthemiddlejurassicofchinadisplayingenigmaticvenationalasymmetry AT shihchungkun newxyelotomidhymenopterafromthemiddlejurassicofchinadisplayingenigmaticvenationalasymmetry AT engelmichaels newxyelotomidhymenopterafromthemiddlejurassicofchinadisplayingenigmaticvenationalasymmetry AT rendong newxyelotomidhymenopterafromthemiddlejurassicofchinadisplayingenigmaticvenationalasymmetry |