Cargando…

A new xyelotomid (Hymenoptera) from the Middle Jurassic of China displaying enigmatic venational asymmetry

BACKGROUND: Pterygota insects typically have symmetric veins in left and right wings. For studying taxonomy and phylogeny of fossil insects, venational patterns are commonly used as diagnostic characters, in conjunction with preserved body characters. Some examples of asymmetrical venation are known...

Descripción completa

Detalles Bibliográficos
Autores principales: Gao, Taiping, Shih, Chungkun, Engel, Michael S., Ren, Dong
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2016
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4971703/
https://www.ncbi.nlm.nih.gov/pubmed/27485108
http://dx.doi.org/10.1186/s12862-016-0730-0
_version_ 1782446153308045312
author Gao, Taiping
Shih, Chungkun
Engel, Michael S.
Ren, Dong
author_facet Gao, Taiping
Shih, Chungkun
Engel, Michael S.
Ren, Dong
author_sort Gao, Taiping
collection PubMed
description BACKGROUND: Pterygota insects typically have symmetric veins in left and right wings. For studying taxonomy and phylogeny of fossil insects, venational patterns are commonly used as diagnostic characters, in conjunction with preserved body characters. Some examples of asymmetrical venation are known among extant insects, but only a few fossil insects with asymmetric wings have been reported, among which a previously described xyelotomid of Hymenoptera, Xyelocerus diaphanous, displays an unusual, small cell of vein Rs in the left forewing, but not in the right. RESULTS: Herein we report a new sawfly of the family Xyelotomidae, Aethotoma aninomorpha gen. et sp. nov., from the late Middle Jurassic of China having a simple Sc in the forewing and Sc with two branches in the hind wing. In additional, the new specimen exhibits an enigmatic venational asymmetry. In the right forewing, crossvein 2r-rs of forms a loop, then forks into 2 long branches reaching Rs, while 2r-rs of the left forewing forks into 2 short branches reaching Rs, in contrast to a linear 2r-rs in typical fossil and extant sawflies. CONCLUSION: Such rare asymmetrical venation found from fossil sawflies provides a glance at early occurrences of venational variability and instability, or possibly aberrational development, for insects in the late Middle Jurassic.
format Online
Article
Text
id pubmed-4971703
institution National Center for Biotechnology Information
language English
publishDate 2016
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-49717032016-08-04 A new xyelotomid (Hymenoptera) from the Middle Jurassic of China displaying enigmatic venational asymmetry Gao, Taiping Shih, Chungkun Engel, Michael S. Ren, Dong BMC Evol Biol Research Article BACKGROUND: Pterygota insects typically have symmetric veins in left and right wings. For studying taxonomy and phylogeny of fossil insects, venational patterns are commonly used as diagnostic characters, in conjunction with preserved body characters. Some examples of asymmetrical venation are known among extant insects, but only a few fossil insects with asymmetric wings have been reported, among which a previously described xyelotomid of Hymenoptera, Xyelocerus diaphanous, displays an unusual, small cell of vein Rs in the left forewing, but not in the right. RESULTS: Herein we report a new sawfly of the family Xyelotomidae, Aethotoma aninomorpha gen. et sp. nov., from the late Middle Jurassic of China having a simple Sc in the forewing and Sc with two branches in the hind wing. In additional, the new specimen exhibits an enigmatic venational asymmetry. In the right forewing, crossvein 2r-rs of forms a loop, then forks into 2 long branches reaching Rs, while 2r-rs of the left forewing forks into 2 short branches reaching Rs, in contrast to a linear 2r-rs in typical fossil and extant sawflies. CONCLUSION: Such rare asymmetrical venation found from fossil sawflies provides a glance at early occurrences of venational variability and instability, or possibly aberrational development, for insects in the late Middle Jurassic. BioMed Central 2016-08-02 /pmc/articles/PMC4971703/ /pubmed/27485108 http://dx.doi.org/10.1186/s12862-016-0730-0 Text en © The Author(s). 2016 Open AccessThis article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated.
spellingShingle Research Article
Gao, Taiping
Shih, Chungkun
Engel, Michael S.
Ren, Dong
A new xyelotomid (Hymenoptera) from the Middle Jurassic of China displaying enigmatic venational asymmetry
title A new xyelotomid (Hymenoptera) from the Middle Jurassic of China displaying enigmatic venational asymmetry
title_full A new xyelotomid (Hymenoptera) from the Middle Jurassic of China displaying enigmatic venational asymmetry
title_fullStr A new xyelotomid (Hymenoptera) from the Middle Jurassic of China displaying enigmatic venational asymmetry
title_full_unstemmed A new xyelotomid (Hymenoptera) from the Middle Jurassic of China displaying enigmatic venational asymmetry
title_short A new xyelotomid (Hymenoptera) from the Middle Jurassic of China displaying enigmatic venational asymmetry
title_sort new xyelotomid (hymenoptera) from the middle jurassic of china displaying enigmatic venational asymmetry
topic Research Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4971703/
https://www.ncbi.nlm.nih.gov/pubmed/27485108
http://dx.doi.org/10.1186/s12862-016-0730-0
work_keys_str_mv AT gaotaiping anewxyelotomidhymenopterafromthemiddlejurassicofchinadisplayingenigmaticvenationalasymmetry
AT shihchungkun anewxyelotomidhymenopterafromthemiddlejurassicofchinadisplayingenigmaticvenationalasymmetry
AT engelmichaels anewxyelotomidhymenopterafromthemiddlejurassicofchinadisplayingenigmaticvenationalasymmetry
AT rendong anewxyelotomidhymenopterafromthemiddlejurassicofchinadisplayingenigmaticvenationalasymmetry
AT gaotaiping newxyelotomidhymenopterafromthemiddlejurassicofchinadisplayingenigmaticvenationalasymmetry
AT shihchungkun newxyelotomidhymenopterafromthemiddlejurassicofchinadisplayingenigmaticvenationalasymmetry
AT engelmichaels newxyelotomidhymenopterafromthemiddlejurassicofchinadisplayingenigmaticvenationalasymmetry
AT rendong newxyelotomidhymenopterafromthemiddlejurassicofchinadisplayingenigmaticvenationalasymmetry