Cargando…

Miniaturizing VEGF: Peptides mimicking the discontinuous VEGF receptor-binding site modulate the angiogenic response

The angiogenic properties of VEGF are mediated through the binding of VEGF to its receptor VEGFR2. The VEGF/VEGFR interface is constituted by a discontinuous binding region distributed on both VEGF monomers. We attempted to reproduce this discontinuous binding site by covalently linking into a singl...

Descripción completa

Detalles Bibliográficos
Autores principales: De Rosa, Lucia, Finetti, Federica, Diana, Donatella, Di Stasi, Rossella, Auriemma, Sara, Romanelli, Alessandra, Fattorusso, Roberto, Ziche, Marina, Morbidelli, Lucia, D’Andrea, Luca Domenico
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Nature Publishing Group 2016
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4976335/
https://www.ncbi.nlm.nih.gov/pubmed/27498819
http://dx.doi.org/10.1038/srep31295
_version_ 1782446855347503104
author De Rosa, Lucia
Finetti, Federica
Diana, Donatella
Di Stasi, Rossella
Auriemma, Sara
Romanelli, Alessandra
Fattorusso, Roberto
Ziche, Marina
Morbidelli, Lucia
D’Andrea, Luca Domenico
author_facet De Rosa, Lucia
Finetti, Federica
Diana, Donatella
Di Stasi, Rossella
Auriemma, Sara
Romanelli, Alessandra
Fattorusso, Roberto
Ziche, Marina
Morbidelli, Lucia
D’Andrea, Luca Domenico
author_sort De Rosa, Lucia
collection PubMed
description The angiogenic properties of VEGF are mediated through the binding of VEGF to its receptor VEGFR2. The VEGF/VEGFR interface is constituted by a discontinuous binding region distributed on both VEGF monomers. We attempted to reproduce this discontinuous binding site by covalently linking into a single molecular entity two VEGF segments involved in receptor recognition. We designed and synthesized by chemical ligation a set of peptides differing in length and flexibility of the molecular linker joining the two VEGF segments. The biological activity of the peptides was characterized in vitro and in vivo showing a VEGF-like activity. The most biologically active mini-VEGF was further analyzed by NMR to determine the atomic details of its interaction with the receptor.
format Online
Article
Text
id pubmed-4976335
institution National Center for Biotechnology Information
language English
publishDate 2016
publisher Nature Publishing Group
record_format MEDLINE/PubMed
spelling pubmed-49763352016-08-22 Miniaturizing VEGF: Peptides mimicking the discontinuous VEGF receptor-binding site modulate the angiogenic response De Rosa, Lucia Finetti, Federica Diana, Donatella Di Stasi, Rossella Auriemma, Sara Romanelli, Alessandra Fattorusso, Roberto Ziche, Marina Morbidelli, Lucia D’Andrea, Luca Domenico Sci Rep Article The angiogenic properties of VEGF are mediated through the binding of VEGF to its receptor VEGFR2. The VEGF/VEGFR interface is constituted by a discontinuous binding region distributed on both VEGF monomers. We attempted to reproduce this discontinuous binding site by covalently linking into a single molecular entity two VEGF segments involved in receptor recognition. We designed and synthesized by chemical ligation a set of peptides differing in length and flexibility of the molecular linker joining the two VEGF segments. The biological activity of the peptides was characterized in vitro and in vivo showing a VEGF-like activity. The most biologically active mini-VEGF was further analyzed by NMR to determine the atomic details of its interaction with the receptor. Nature Publishing Group 2016-08-08 /pmc/articles/PMC4976335/ /pubmed/27498819 http://dx.doi.org/10.1038/srep31295 Text en Copyright © 2016, The Author(s) http://creativecommons.org/licenses/by/4.0/ This work is licensed under a Creative Commons Attribution 4.0 International License. The images or other third party material in this article are included in the article’s Creative Commons license, unless indicated otherwise in the credit line; if the material is not included under the Creative Commons license, users will need to obtain permission from the license holder to reproduce the material. To view a copy of this license, visit http://creativecommons.org/licenses/by/4.0/
spellingShingle Article
De Rosa, Lucia
Finetti, Federica
Diana, Donatella
Di Stasi, Rossella
Auriemma, Sara
Romanelli, Alessandra
Fattorusso, Roberto
Ziche, Marina
Morbidelli, Lucia
D’Andrea, Luca Domenico
Miniaturizing VEGF: Peptides mimicking the discontinuous VEGF receptor-binding site modulate the angiogenic response
title Miniaturizing VEGF: Peptides mimicking the discontinuous VEGF receptor-binding site modulate the angiogenic response
title_full Miniaturizing VEGF: Peptides mimicking the discontinuous VEGF receptor-binding site modulate the angiogenic response
title_fullStr Miniaturizing VEGF: Peptides mimicking the discontinuous VEGF receptor-binding site modulate the angiogenic response
title_full_unstemmed Miniaturizing VEGF: Peptides mimicking the discontinuous VEGF receptor-binding site modulate the angiogenic response
title_short Miniaturizing VEGF: Peptides mimicking the discontinuous VEGF receptor-binding site modulate the angiogenic response
title_sort miniaturizing vegf: peptides mimicking the discontinuous vegf receptor-binding site modulate the angiogenic response
topic Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4976335/
https://www.ncbi.nlm.nih.gov/pubmed/27498819
http://dx.doi.org/10.1038/srep31295
work_keys_str_mv AT derosalucia miniaturizingvegfpeptidesmimickingthediscontinuousvegfreceptorbindingsitemodulatetheangiogenicresponse
AT finettifederica miniaturizingvegfpeptidesmimickingthediscontinuousvegfreceptorbindingsitemodulatetheangiogenicresponse
AT dianadonatella miniaturizingvegfpeptidesmimickingthediscontinuousvegfreceptorbindingsitemodulatetheangiogenicresponse
AT distasirossella miniaturizingvegfpeptidesmimickingthediscontinuousvegfreceptorbindingsitemodulatetheangiogenicresponse
AT auriemmasara miniaturizingvegfpeptidesmimickingthediscontinuousvegfreceptorbindingsitemodulatetheangiogenicresponse
AT romanellialessandra miniaturizingvegfpeptidesmimickingthediscontinuousvegfreceptorbindingsitemodulatetheangiogenicresponse
AT fattorussoroberto miniaturizingvegfpeptidesmimickingthediscontinuousvegfreceptorbindingsitemodulatetheangiogenicresponse
AT zichemarina miniaturizingvegfpeptidesmimickingthediscontinuousvegfreceptorbindingsitemodulatetheangiogenicresponse
AT morbidellilucia miniaturizingvegfpeptidesmimickingthediscontinuousvegfreceptorbindingsitemodulatetheangiogenicresponse
AT dandrealucadomenico miniaturizingvegfpeptidesmimickingthediscontinuousvegfreceptorbindingsitemodulatetheangiogenicresponse