Cargando…
Miniaturizing VEGF: Peptides mimicking the discontinuous VEGF receptor-binding site modulate the angiogenic response
The angiogenic properties of VEGF are mediated through the binding of VEGF to its receptor VEGFR2. The VEGF/VEGFR interface is constituted by a discontinuous binding region distributed on both VEGF monomers. We attempted to reproduce this discontinuous binding site by covalently linking into a singl...
Autores principales: | , , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Nature Publishing Group
2016
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4976335/ https://www.ncbi.nlm.nih.gov/pubmed/27498819 http://dx.doi.org/10.1038/srep31295 |
_version_ | 1782446855347503104 |
---|---|
author | De Rosa, Lucia Finetti, Federica Diana, Donatella Di Stasi, Rossella Auriemma, Sara Romanelli, Alessandra Fattorusso, Roberto Ziche, Marina Morbidelli, Lucia D’Andrea, Luca Domenico |
author_facet | De Rosa, Lucia Finetti, Federica Diana, Donatella Di Stasi, Rossella Auriemma, Sara Romanelli, Alessandra Fattorusso, Roberto Ziche, Marina Morbidelli, Lucia D’Andrea, Luca Domenico |
author_sort | De Rosa, Lucia |
collection | PubMed |
description | The angiogenic properties of VEGF are mediated through the binding of VEGF to its receptor VEGFR2. The VEGF/VEGFR interface is constituted by a discontinuous binding region distributed on both VEGF monomers. We attempted to reproduce this discontinuous binding site by covalently linking into a single molecular entity two VEGF segments involved in receptor recognition. We designed and synthesized by chemical ligation a set of peptides differing in length and flexibility of the molecular linker joining the two VEGF segments. The biological activity of the peptides was characterized in vitro and in vivo showing a VEGF-like activity. The most biologically active mini-VEGF was further analyzed by NMR to determine the atomic details of its interaction with the receptor. |
format | Online Article Text |
id | pubmed-4976335 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2016 |
publisher | Nature Publishing Group |
record_format | MEDLINE/PubMed |
spelling | pubmed-49763352016-08-22 Miniaturizing VEGF: Peptides mimicking the discontinuous VEGF receptor-binding site modulate the angiogenic response De Rosa, Lucia Finetti, Federica Diana, Donatella Di Stasi, Rossella Auriemma, Sara Romanelli, Alessandra Fattorusso, Roberto Ziche, Marina Morbidelli, Lucia D’Andrea, Luca Domenico Sci Rep Article The angiogenic properties of VEGF are mediated through the binding of VEGF to its receptor VEGFR2. The VEGF/VEGFR interface is constituted by a discontinuous binding region distributed on both VEGF monomers. We attempted to reproduce this discontinuous binding site by covalently linking into a single molecular entity two VEGF segments involved in receptor recognition. We designed and synthesized by chemical ligation a set of peptides differing in length and flexibility of the molecular linker joining the two VEGF segments. The biological activity of the peptides was characterized in vitro and in vivo showing a VEGF-like activity. The most biologically active mini-VEGF was further analyzed by NMR to determine the atomic details of its interaction with the receptor. Nature Publishing Group 2016-08-08 /pmc/articles/PMC4976335/ /pubmed/27498819 http://dx.doi.org/10.1038/srep31295 Text en Copyright © 2016, The Author(s) http://creativecommons.org/licenses/by/4.0/ This work is licensed under a Creative Commons Attribution 4.0 International License. The images or other third party material in this article are included in the article’s Creative Commons license, unless indicated otherwise in the credit line; if the material is not included under the Creative Commons license, users will need to obtain permission from the license holder to reproduce the material. To view a copy of this license, visit http://creativecommons.org/licenses/by/4.0/ |
spellingShingle | Article De Rosa, Lucia Finetti, Federica Diana, Donatella Di Stasi, Rossella Auriemma, Sara Romanelli, Alessandra Fattorusso, Roberto Ziche, Marina Morbidelli, Lucia D’Andrea, Luca Domenico Miniaturizing VEGF: Peptides mimicking the discontinuous VEGF receptor-binding site modulate the angiogenic response |
title | Miniaturizing VEGF: Peptides mimicking the discontinuous VEGF receptor-binding site modulate the angiogenic response |
title_full | Miniaturizing VEGF: Peptides mimicking the discontinuous VEGF receptor-binding site modulate the angiogenic response |
title_fullStr | Miniaturizing VEGF: Peptides mimicking the discontinuous VEGF receptor-binding site modulate the angiogenic response |
title_full_unstemmed | Miniaturizing VEGF: Peptides mimicking the discontinuous VEGF receptor-binding site modulate the angiogenic response |
title_short | Miniaturizing VEGF: Peptides mimicking the discontinuous VEGF receptor-binding site modulate the angiogenic response |
title_sort | miniaturizing vegf: peptides mimicking the discontinuous vegf receptor-binding site modulate the angiogenic response |
topic | Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4976335/ https://www.ncbi.nlm.nih.gov/pubmed/27498819 http://dx.doi.org/10.1038/srep31295 |
work_keys_str_mv | AT derosalucia miniaturizingvegfpeptidesmimickingthediscontinuousvegfreceptorbindingsitemodulatetheangiogenicresponse AT finettifederica miniaturizingvegfpeptidesmimickingthediscontinuousvegfreceptorbindingsitemodulatetheangiogenicresponse AT dianadonatella miniaturizingvegfpeptidesmimickingthediscontinuousvegfreceptorbindingsitemodulatetheangiogenicresponse AT distasirossella miniaturizingvegfpeptidesmimickingthediscontinuousvegfreceptorbindingsitemodulatetheangiogenicresponse AT auriemmasara miniaturizingvegfpeptidesmimickingthediscontinuousvegfreceptorbindingsitemodulatetheangiogenicresponse AT romanellialessandra miniaturizingvegfpeptidesmimickingthediscontinuousvegfreceptorbindingsitemodulatetheangiogenicresponse AT fattorussoroberto miniaturizingvegfpeptidesmimickingthediscontinuousvegfreceptorbindingsitemodulatetheangiogenicresponse AT zichemarina miniaturizingvegfpeptidesmimickingthediscontinuousvegfreceptorbindingsitemodulatetheangiogenicresponse AT morbidellilucia miniaturizingvegfpeptidesmimickingthediscontinuousvegfreceptorbindingsitemodulatetheangiogenicresponse AT dandrealucadomenico miniaturizingvegfpeptidesmimickingthediscontinuousvegfreceptorbindingsitemodulatetheangiogenicresponse |