Cargando…
Genome-wide identification and characterization of the NF-Y gene family in grape (vitis vinifera L.)
BACKGROUND: Nuclear factor Y (NF-Y) transcription factor is composed of three distinct subunits: NF-YA, NF-YB and NF-YC. Many members of NF-Y family have been reported to be key regulators in plant development, phytohormone signaling and drought tolerance. However, the function of the NF-Y family is...
Autores principales: | , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2016
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4982312/ https://www.ncbi.nlm.nih.gov/pubmed/27516172 http://dx.doi.org/10.1186/s12864-016-2989-3 |
_version_ | 1782447761593991168 |
---|---|
author | Ren, Chong Zhang, Zhan Wang, Yi Li, Shaohua Liang, Zhenchang |
author_facet | Ren, Chong Zhang, Zhan Wang, Yi Li, Shaohua Liang, Zhenchang |
author_sort | Ren, Chong |
collection | PubMed |
description | BACKGROUND: Nuclear factor Y (NF-Y) transcription factor is composed of three distinct subunits: NF-YA, NF-YB and NF-YC. Many members of NF-Y family have been reported to be key regulators in plant development, phytohormone signaling and drought tolerance. However, the function of the NF-Y family is less known in grape (Vitis vinifera L.). RESULTS: A total of 34 grape NF-Y genes that distributed unevenly on grape (V. vinifera) chromosomes were identified in this study. Phylogenetic analysis was performed to predict functional similarities between Arabidopsis thaliana and grape NF-Y genes. Comparison of the structures of grape NF-Y genes (VvNF-Ys) revealed their functional conservation and alteration. Furthermore, we investigated the expression profiles of VvNF-Ys in response to various stresses, phytohormone treatments, and in leaves and grape berries with various sugar contents at different developmental stages. The relationship between VvNF-Y transcript levels and sugar content was examined to select candidates for exogenous sugar treatments. Quantitative real-time PCR (qPCR) indicated that many VvNF-Ys responded to different sugar stimuli with variations in transcript abundance. qPCR and publicly available microarray data suggest that VvNF-Ys exhibit distinct expression patterns in different grape organs and developmental stages, and a number of VvNF-Ys may participate in responses to multiple abiotic and biotic stresses, phytohormone treatments and sugar accumulation or metabolism. CONCLUSIONS: In this study, we characterized 34 VvNF-Ys based on their distributions on chromosomes, gene structures, phylogenetic relationship with Arabidopsis NF-Y genes, and their expression patterns. The potential roles of VvNF-Ys in sugar accumulation or metabolism were also investigated. Altogether, the data provide significant insights on VvNF-Ys, and lay foundations for further functional studies of NF-Y genes in grape. ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (doi:10.1186/s12864-016-2989-3) contains supplementary material, which is available to authorized users. |
format | Online Article Text |
id | pubmed-4982312 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2016 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-49823122016-08-13 Genome-wide identification and characterization of the NF-Y gene family in grape (vitis vinifera L.) Ren, Chong Zhang, Zhan Wang, Yi Li, Shaohua Liang, Zhenchang BMC Genomics Research Article BACKGROUND: Nuclear factor Y (NF-Y) transcription factor is composed of three distinct subunits: NF-YA, NF-YB and NF-YC. Many members of NF-Y family have been reported to be key regulators in plant development, phytohormone signaling and drought tolerance. However, the function of the NF-Y family is less known in grape (Vitis vinifera L.). RESULTS: A total of 34 grape NF-Y genes that distributed unevenly on grape (V. vinifera) chromosomes were identified in this study. Phylogenetic analysis was performed to predict functional similarities between Arabidopsis thaliana and grape NF-Y genes. Comparison of the structures of grape NF-Y genes (VvNF-Ys) revealed their functional conservation and alteration. Furthermore, we investigated the expression profiles of VvNF-Ys in response to various stresses, phytohormone treatments, and in leaves and grape berries with various sugar contents at different developmental stages. The relationship between VvNF-Y transcript levels and sugar content was examined to select candidates for exogenous sugar treatments. Quantitative real-time PCR (qPCR) indicated that many VvNF-Ys responded to different sugar stimuli with variations in transcript abundance. qPCR and publicly available microarray data suggest that VvNF-Ys exhibit distinct expression patterns in different grape organs and developmental stages, and a number of VvNF-Ys may participate in responses to multiple abiotic and biotic stresses, phytohormone treatments and sugar accumulation or metabolism. CONCLUSIONS: In this study, we characterized 34 VvNF-Ys based on their distributions on chromosomes, gene structures, phylogenetic relationship with Arabidopsis NF-Y genes, and their expression patterns. The potential roles of VvNF-Ys in sugar accumulation or metabolism were also investigated. Altogether, the data provide significant insights on VvNF-Ys, and lay foundations for further functional studies of NF-Y genes in grape. ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (doi:10.1186/s12864-016-2989-3) contains supplementary material, which is available to authorized users. BioMed Central 2016-08-11 /pmc/articles/PMC4982312/ /pubmed/27516172 http://dx.doi.org/10.1186/s12864-016-2989-3 Text en © The Author(s). 2016 Open AccessThis article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated. |
spellingShingle | Research Article Ren, Chong Zhang, Zhan Wang, Yi Li, Shaohua Liang, Zhenchang Genome-wide identification and characterization of the NF-Y gene family in grape (vitis vinifera L.) |
title | Genome-wide identification and characterization of the NF-Y gene family in grape (vitis vinifera L.) |
title_full | Genome-wide identification and characterization of the NF-Y gene family in grape (vitis vinifera L.) |
title_fullStr | Genome-wide identification and characterization of the NF-Y gene family in grape (vitis vinifera L.) |
title_full_unstemmed | Genome-wide identification and characterization of the NF-Y gene family in grape (vitis vinifera L.) |
title_short | Genome-wide identification and characterization of the NF-Y gene family in grape (vitis vinifera L.) |
title_sort | genome-wide identification and characterization of the nf-y gene family in grape (vitis vinifera l.) |
topic | Research Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4982312/ https://www.ncbi.nlm.nih.gov/pubmed/27516172 http://dx.doi.org/10.1186/s12864-016-2989-3 |
work_keys_str_mv | AT renchong genomewideidentificationandcharacterizationofthenfygenefamilyingrapevitisviniferal AT zhangzhan genomewideidentificationandcharacterizationofthenfygenefamilyingrapevitisviniferal AT wangyi genomewideidentificationandcharacterizationofthenfygenefamilyingrapevitisviniferal AT lishaohua genomewideidentificationandcharacterizationofthenfygenefamilyingrapevitisviniferal AT liangzhenchang genomewideidentificationandcharacterizationofthenfygenefamilyingrapevitisviniferal |