Cargando…
Genome analysis and avirulence gene cloning using a high-density RADseq linkage map of the flax rust fungus, Melampsora lini
BACKGROUND: Rust fungi are an important group of plant pathogens that cause devastating losses in agricultural, silvicultural and natural ecosystems. Plants can be protected from rust disease by resistance genes encoding receptors that trigger a highly effective defence response upon recognition of...
Autores principales: | , , , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2016
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4994203/ https://www.ncbi.nlm.nih.gov/pubmed/27550217 http://dx.doi.org/10.1186/s12864-016-3011-9 |
_version_ | 1782449279021875200 |
---|---|
author | Anderson, Claire Khan, Muhammad Adil Catanzariti, Ann-Maree Jack, Cameron A. Nemri, Adnane Lawrence, Gregory J. Upadhyaya, Narayana M. Hardham, Adrienne R. Ellis, Jeffrey G. Dodds, Peter N. Jones, David A. |
author_facet | Anderson, Claire Khan, Muhammad Adil Catanzariti, Ann-Maree Jack, Cameron A. Nemri, Adnane Lawrence, Gregory J. Upadhyaya, Narayana M. Hardham, Adrienne R. Ellis, Jeffrey G. Dodds, Peter N. Jones, David A. |
author_sort | Anderson, Claire |
collection | PubMed |
description | BACKGROUND: Rust fungi are an important group of plant pathogens that cause devastating losses in agricultural, silvicultural and natural ecosystems. Plants can be protected from rust disease by resistance genes encoding receptors that trigger a highly effective defence response upon recognition of specific pathogen avirulence proteins. Identifying avirulence genes is crucial for understanding how virulence evolves in the field. RESULTS: To facilitate avirulence gene cloning in the flax rust fungus, Melampsora lini, we constructed a high-density genetic linkage map using single nucleotide polymorphisms detected in restriction site-associated DNA sequencing (RADseq) data. The map comprises 13,412 RADseq markers in 27 linkage groups that together span 5860 cM and contain 2756 recombination bins. The marker sequences were used to anchor 68.9 % of the M. lini genome assembly onto the genetic map. The map and anchored assembly were then used to: 1) show that M. lini has a high overall meiotic recombination rate, but recombination distribution is uneven and large coldspots exist; 2) show that substantial genome rearrangements have occurred in spontaneous loss-of-avirulence mutants; and 3) identify the AvrL2 and AvrM14 avirulence genes by map-based cloning. AvrM14 is a dual-specificity avirulence gene that encodes a predicted nudix hydrolase. AvrL2 is located in the region of the M. lini genome with the lowest recombination rate and encodes a small, highly-charged proline-rich protein. CONCLUSIONS: The M. lini high-density linkage map has greatly advanced our understanding of virulence mechanisms in this pathogen by providing novel insights into genome variability and enabling identification of two new avirulence genes. ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (doi:10.1186/s12864-016-3011-9) contains supplementary material, which is available to authorized users. |
format | Online Article Text |
id | pubmed-4994203 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2016 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-49942032016-08-24 Genome analysis and avirulence gene cloning using a high-density RADseq linkage map of the flax rust fungus, Melampsora lini Anderson, Claire Khan, Muhammad Adil Catanzariti, Ann-Maree Jack, Cameron A. Nemri, Adnane Lawrence, Gregory J. Upadhyaya, Narayana M. Hardham, Adrienne R. Ellis, Jeffrey G. Dodds, Peter N. Jones, David A. BMC Genomics Research Article BACKGROUND: Rust fungi are an important group of plant pathogens that cause devastating losses in agricultural, silvicultural and natural ecosystems. Plants can be protected from rust disease by resistance genes encoding receptors that trigger a highly effective defence response upon recognition of specific pathogen avirulence proteins. Identifying avirulence genes is crucial for understanding how virulence evolves in the field. RESULTS: To facilitate avirulence gene cloning in the flax rust fungus, Melampsora lini, we constructed a high-density genetic linkage map using single nucleotide polymorphisms detected in restriction site-associated DNA sequencing (RADseq) data. The map comprises 13,412 RADseq markers in 27 linkage groups that together span 5860 cM and contain 2756 recombination bins. The marker sequences were used to anchor 68.9 % of the M. lini genome assembly onto the genetic map. The map and anchored assembly were then used to: 1) show that M. lini has a high overall meiotic recombination rate, but recombination distribution is uneven and large coldspots exist; 2) show that substantial genome rearrangements have occurred in spontaneous loss-of-avirulence mutants; and 3) identify the AvrL2 and AvrM14 avirulence genes by map-based cloning. AvrM14 is a dual-specificity avirulence gene that encodes a predicted nudix hydrolase. AvrL2 is located in the region of the M. lini genome with the lowest recombination rate and encodes a small, highly-charged proline-rich protein. CONCLUSIONS: The M. lini high-density linkage map has greatly advanced our understanding of virulence mechanisms in this pathogen by providing novel insights into genome variability and enabling identification of two new avirulence genes. ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (doi:10.1186/s12864-016-3011-9) contains supplementary material, which is available to authorized users. BioMed Central 2016-08-22 /pmc/articles/PMC4994203/ /pubmed/27550217 http://dx.doi.org/10.1186/s12864-016-3011-9 Text en © The Author(s). 2016 Open AccessThis article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated. |
spellingShingle | Research Article Anderson, Claire Khan, Muhammad Adil Catanzariti, Ann-Maree Jack, Cameron A. Nemri, Adnane Lawrence, Gregory J. Upadhyaya, Narayana M. Hardham, Adrienne R. Ellis, Jeffrey G. Dodds, Peter N. Jones, David A. Genome analysis and avirulence gene cloning using a high-density RADseq linkage map of the flax rust fungus, Melampsora lini |
title | Genome analysis and avirulence gene cloning using a high-density RADseq linkage map of the flax rust fungus, Melampsora lini |
title_full | Genome analysis and avirulence gene cloning using a high-density RADseq linkage map of the flax rust fungus, Melampsora lini |
title_fullStr | Genome analysis and avirulence gene cloning using a high-density RADseq linkage map of the flax rust fungus, Melampsora lini |
title_full_unstemmed | Genome analysis and avirulence gene cloning using a high-density RADseq linkage map of the flax rust fungus, Melampsora lini |
title_short | Genome analysis and avirulence gene cloning using a high-density RADseq linkage map of the flax rust fungus, Melampsora lini |
title_sort | genome analysis and avirulence gene cloning using a high-density radseq linkage map of the flax rust fungus, melampsora lini |
topic | Research Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4994203/ https://www.ncbi.nlm.nih.gov/pubmed/27550217 http://dx.doi.org/10.1186/s12864-016-3011-9 |
work_keys_str_mv | AT andersonclaire genomeanalysisandavirulencegenecloningusingahighdensityradseqlinkagemapoftheflaxrustfungusmelampsoralini AT khanmuhammadadil genomeanalysisandavirulencegenecloningusingahighdensityradseqlinkagemapoftheflaxrustfungusmelampsoralini AT catanzaritiannmaree genomeanalysisandavirulencegenecloningusingahighdensityradseqlinkagemapoftheflaxrustfungusmelampsoralini AT jackcamerona genomeanalysisandavirulencegenecloningusingahighdensityradseqlinkagemapoftheflaxrustfungusmelampsoralini AT nemriadnane genomeanalysisandavirulencegenecloningusingahighdensityradseqlinkagemapoftheflaxrustfungusmelampsoralini AT lawrencegregoryj genomeanalysisandavirulencegenecloningusingahighdensityradseqlinkagemapoftheflaxrustfungusmelampsoralini AT upadhyayanarayanam genomeanalysisandavirulencegenecloningusingahighdensityradseqlinkagemapoftheflaxrustfungusmelampsoralini AT hardhamadrienner genomeanalysisandavirulencegenecloningusingahighdensityradseqlinkagemapoftheflaxrustfungusmelampsoralini AT ellisjeffreyg genomeanalysisandavirulencegenecloningusingahighdensityradseqlinkagemapoftheflaxrustfungusmelampsoralini AT doddspetern genomeanalysisandavirulencegenecloningusingahighdensityradseqlinkagemapoftheflaxrustfungusmelampsoralini AT jonesdavida genomeanalysisandavirulencegenecloningusingahighdensityradseqlinkagemapoftheflaxrustfungusmelampsoralini |