Cargando…

Effects of Maternal Chromium Restriction on the Long-Term Programming in MAPK Signaling Pathway of Lipid Metabolism in Mice

It is now broadly accepted that the nutritional environment in early life is a key factor in susceptibility to metabolic diseases. In this study, we evaluated the effects of maternal chromium restriction in vivo on the modulation of lipid metabolism and the mechanisms involved in this process. Sixte...

Descripción completa

Detalles Bibliográficos
Autores principales: Zhang, Qian, Sun, Xiaofang, Xiao, Xinhua, Zheng, Jia, Li, Ming, Yu, Miao, Ping, Fan, Wang, Zhixin, Qi, Cuijuan, Wang, Tong, Wang, Xiaojing
Formato: Online Artículo Texto
Lenguaje:English
Publicado: MDPI 2016
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4997401/
https://www.ncbi.nlm.nih.gov/pubmed/27517955
http://dx.doi.org/10.3390/nu8080488
_version_ 1782449765864177664
author Zhang, Qian
Sun, Xiaofang
Xiao, Xinhua
Zheng, Jia
Li, Ming
Yu, Miao
Ping, Fan
Wang, Zhixin
Qi, Cuijuan
Wang, Tong
Wang, Xiaojing
author_facet Zhang, Qian
Sun, Xiaofang
Xiao, Xinhua
Zheng, Jia
Li, Ming
Yu, Miao
Ping, Fan
Wang, Zhixin
Qi, Cuijuan
Wang, Tong
Wang, Xiaojing
author_sort Zhang, Qian
collection PubMed
description It is now broadly accepted that the nutritional environment in early life is a key factor in susceptibility to metabolic diseases. In this study, we evaluated the effects of maternal chromium restriction in vivo on the modulation of lipid metabolism and the mechanisms involved in this process. Sixteen pregnant C57BL mice were randomly divided into two dietary treatments: a control (C) diet group and a low chromium (L) diet group. The diet treatment was maintained through gestation and lactation period. After weaning, some of the pups continued with either the control diet or low chromium diet (CC or LL), whereas other pups switched to another diet (CL or LC). At 32 weeks of age, serum lipid metabolism, proinflammatory indexes, oxidative stress and anti-oxidant markers, and DNA methylation status in adipose tissue were measured. The results indicated that the maternal low chromium diet increased body weight, fat pad weight, serum triglyceride (TG), low-density lipoprotein cholesterol (LDL), tumor necrosis factor-α (TNF-α), malondialdehyde (MDA), and oxidized glutathione (GSSG). There was a decrease in serum reduced/oxidized glutathione (GSH/GSSG) ratio at 32 weeks of age in female offspring. From adipose tissue, we identified 1214 individual hypomethylated CpG sites and 411 individual hypermethylated CpG sites in the LC group when compared to the CC group. Pathway analysis of the differential methylation genes revealed a significant increase in hypomethylated genes in the mitogen-activated protein kinase (MAPK) signaling pathway in the LC group. Our study highlights the importance of the MAPK signaling pathway in epigenetic changes involved in the lipid metabolism of the offspring from chromium-restricted dams.
format Online
Article
Text
id pubmed-4997401
institution National Center for Biotechnology Information
language English
publishDate 2016
publisher MDPI
record_format MEDLINE/PubMed
spelling pubmed-49974012016-08-26 Effects of Maternal Chromium Restriction on the Long-Term Programming in MAPK Signaling Pathway of Lipid Metabolism in Mice Zhang, Qian Sun, Xiaofang Xiao, Xinhua Zheng, Jia Li, Ming Yu, Miao Ping, Fan Wang, Zhixin Qi, Cuijuan Wang, Tong Wang, Xiaojing Nutrients Article It is now broadly accepted that the nutritional environment in early life is a key factor in susceptibility to metabolic diseases. In this study, we evaluated the effects of maternal chromium restriction in vivo on the modulation of lipid metabolism and the mechanisms involved in this process. Sixteen pregnant C57BL mice were randomly divided into two dietary treatments: a control (C) diet group and a low chromium (L) diet group. The diet treatment was maintained through gestation and lactation period. After weaning, some of the pups continued with either the control diet or low chromium diet (CC or LL), whereas other pups switched to another diet (CL or LC). At 32 weeks of age, serum lipid metabolism, proinflammatory indexes, oxidative stress and anti-oxidant markers, and DNA methylation status in adipose tissue were measured. The results indicated that the maternal low chromium diet increased body weight, fat pad weight, serum triglyceride (TG), low-density lipoprotein cholesterol (LDL), tumor necrosis factor-α (TNF-α), malondialdehyde (MDA), and oxidized glutathione (GSSG). There was a decrease in serum reduced/oxidized glutathione (GSH/GSSG) ratio at 32 weeks of age in female offspring. From adipose tissue, we identified 1214 individual hypomethylated CpG sites and 411 individual hypermethylated CpG sites in the LC group when compared to the CC group. Pathway analysis of the differential methylation genes revealed a significant increase in hypomethylated genes in the mitogen-activated protein kinase (MAPK) signaling pathway in the LC group. Our study highlights the importance of the MAPK signaling pathway in epigenetic changes involved in the lipid metabolism of the offspring from chromium-restricted dams. MDPI 2016-08-10 /pmc/articles/PMC4997401/ /pubmed/27517955 http://dx.doi.org/10.3390/nu8080488 Text en © 2016 by the authors; licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC-BY) license (http://creativecommons.org/licenses/by/4.0/).
spellingShingle Article
Zhang, Qian
Sun, Xiaofang
Xiao, Xinhua
Zheng, Jia
Li, Ming
Yu, Miao
Ping, Fan
Wang, Zhixin
Qi, Cuijuan
Wang, Tong
Wang, Xiaojing
Effects of Maternal Chromium Restriction on the Long-Term Programming in MAPK Signaling Pathway of Lipid Metabolism in Mice
title Effects of Maternal Chromium Restriction on the Long-Term Programming in MAPK Signaling Pathway of Lipid Metabolism in Mice
title_full Effects of Maternal Chromium Restriction on the Long-Term Programming in MAPK Signaling Pathway of Lipid Metabolism in Mice
title_fullStr Effects of Maternal Chromium Restriction on the Long-Term Programming in MAPK Signaling Pathway of Lipid Metabolism in Mice
title_full_unstemmed Effects of Maternal Chromium Restriction on the Long-Term Programming in MAPK Signaling Pathway of Lipid Metabolism in Mice
title_short Effects of Maternal Chromium Restriction on the Long-Term Programming in MAPK Signaling Pathway of Lipid Metabolism in Mice
title_sort effects of maternal chromium restriction on the long-term programming in mapk signaling pathway of lipid metabolism in mice
topic Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4997401/
https://www.ncbi.nlm.nih.gov/pubmed/27517955
http://dx.doi.org/10.3390/nu8080488
work_keys_str_mv AT zhangqian effectsofmaternalchromiumrestrictiononthelongtermprogramminginmapksignalingpathwayoflipidmetabolisminmice
AT sunxiaofang effectsofmaternalchromiumrestrictiononthelongtermprogramminginmapksignalingpathwayoflipidmetabolisminmice
AT xiaoxinhua effectsofmaternalchromiumrestrictiononthelongtermprogramminginmapksignalingpathwayoflipidmetabolisminmice
AT zhengjia effectsofmaternalchromiumrestrictiononthelongtermprogramminginmapksignalingpathwayoflipidmetabolisminmice
AT liming effectsofmaternalchromiumrestrictiononthelongtermprogramminginmapksignalingpathwayoflipidmetabolisminmice
AT yumiao effectsofmaternalchromiumrestrictiononthelongtermprogramminginmapksignalingpathwayoflipidmetabolisminmice
AT pingfan effectsofmaternalchromiumrestrictiononthelongtermprogramminginmapksignalingpathwayoflipidmetabolisminmice
AT wangzhixin effectsofmaternalchromiumrestrictiononthelongtermprogramminginmapksignalingpathwayoflipidmetabolisminmice
AT qicuijuan effectsofmaternalchromiumrestrictiononthelongtermprogramminginmapksignalingpathwayoflipidmetabolisminmice
AT wangtong effectsofmaternalchromiumrestrictiononthelongtermprogramminginmapksignalingpathwayoflipidmetabolisminmice
AT wangxiaojing effectsofmaternalchromiumrestrictiononthelongtermprogramminginmapksignalingpathwayoflipidmetabolisminmice