Cargando…
Effects of Maternal Chromium Restriction on the Long-Term Programming in MAPK Signaling Pathway of Lipid Metabolism in Mice
It is now broadly accepted that the nutritional environment in early life is a key factor in susceptibility to metabolic diseases. In this study, we evaluated the effects of maternal chromium restriction in vivo on the modulation of lipid metabolism and the mechanisms involved in this process. Sixte...
Autores principales: | , , , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
MDPI
2016
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4997401/ https://www.ncbi.nlm.nih.gov/pubmed/27517955 http://dx.doi.org/10.3390/nu8080488 |
_version_ | 1782449765864177664 |
---|---|
author | Zhang, Qian Sun, Xiaofang Xiao, Xinhua Zheng, Jia Li, Ming Yu, Miao Ping, Fan Wang, Zhixin Qi, Cuijuan Wang, Tong Wang, Xiaojing |
author_facet | Zhang, Qian Sun, Xiaofang Xiao, Xinhua Zheng, Jia Li, Ming Yu, Miao Ping, Fan Wang, Zhixin Qi, Cuijuan Wang, Tong Wang, Xiaojing |
author_sort | Zhang, Qian |
collection | PubMed |
description | It is now broadly accepted that the nutritional environment in early life is a key factor in susceptibility to metabolic diseases. In this study, we evaluated the effects of maternal chromium restriction in vivo on the modulation of lipid metabolism and the mechanisms involved in this process. Sixteen pregnant C57BL mice were randomly divided into two dietary treatments: a control (C) diet group and a low chromium (L) diet group. The diet treatment was maintained through gestation and lactation period. After weaning, some of the pups continued with either the control diet or low chromium diet (CC or LL), whereas other pups switched to another diet (CL or LC). At 32 weeks of age, serum lipid metabolism, proinflammatory indexes, oxidative stress and anti-oxidant markers, and DNA methylation status in adipose tissue were measured. The results indicated that the maternal low chromium diet increased body weight, fat pad weight, serum triglyceride (TG), low-density lipoprotein cholesterol (LDL), tumor necrosis factor-α (TNF-α), malondialdehyde (MDA), and oxidized glutathione (GSSG). There was a decrease in serum reduced/oxidized glutathione (GSH/GSSG) ratio at 32 weeks of age in female offspring. From adipose tissue, we identified 1214 individual hypomethylated CpG sites and 411 individual hypermethylated CpG sites in the LC group when compared to the CC group. Pathway analysis of the differential methylation genes revealed a significant increase in hypomethylated genes in the mitogen-activated protein kinase (MAPK) signaling pathway in the LC group. Our study highlights the importance of the MAPK signaling pathway in epigenetic changes involved in the lipid metabolism of the offspring from chromium-restricted dams. |
format | Online Article Text |
id | pubmed-4997401 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2016 |
publisher | MDPI |
record_format | MEDLINE/PubMed |
spelling | pubmed-49974012016-08-26 Effects of Maternal Chromium Restriction on the Long-Term Programming in MAPK Signaling Pathway of Lipid Metabolism in Mice Zhang, Qian Sun, Xiaofang Xiao, Xinhua Zheng, Jia Li, Ming Yu, Miao Ping, Fan Wang, Zhixin Qi, Cuijuan Wang, Tong Wang, Xiaojing Nutrients Article It is now broadly accepted that the nutritional environment in early life is a key factor in susceptibility to metabolic diseases. In this study, we evaluated the effects of maternal chromium restriction in vivo on the modulation of lipid metabolism and the mechanisms involved in this process. Sixteen pregnant C57BL mice were randomly divided into two dietary treatments: a control (C) diet group and a low chromium (L) diet group. The diet treatment was maintained through gestation and lactation period. After weaning, some of the pups continued with either the control diet or low chromium diet (CC or LL), whereas other pups switched to another diet (CL or LC). At 32 weeks of age, serum lipid metabolism, proinflammatory indexes, oxidative stress and anti-oxidant markers, and DNA methylation status in adipose tissue were measured. The results indicated that the maternal low chromium diet increased body weight, fat pad weight, serum triglyceride (TG), low-density lipoprotein cholesterol (LDL), tumor necrosis factor-α (TNF-α), malondialdehyde (MDA), and oxidized glutathione (GSSG). There was a decrease in serum reduced/oxidized glutathione (GSH/GSSG) ratio at 32 weeks of age in female offspring. From adipose tissue, we identified 1214 individual hypomethylated CpG sites and 411 individual hypermethylated CpG sites in the LC group when compared to the CC group. Pathway analysis of the differential methylation genes revealed a significant increase in hypomethylated genes in the mitogen-activated protein kinase (MAPK) signaling pathway in the LC group. Our study highlights the importance of the MAPK signaling pathway in epigenetic changes involved in the lipid metabolism of the offspring from chromium-restricted dams. MDPI 2016-08-10 /pmc/articles/PMC4997401/ /pubmed/27517955 http://dx.doi.org/10.3390/nu8080488 Text en © 2016 by the authors; licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC-BY) license (http://creativecommons.org/licenses/by/4.0/). |
spellingShingle | Article Zhang, Qian Sun, Xiaofang Xiao, Xinhua Zheng, Jia Li, Ming Yu, Miao Ping, Fan Wang, Zhixin Qi, Cuijuan Wang, Tong Wang, Xiaojing Effects of Maternal Chromium Restriction on the Long-Term Programming in MAPK Signaling Pathway of Lipid Metabolism in Mice |
title | Effects of Maternal Chromium Restriction on the Long-Term Programming in MAPK Signaling Pathway of Lipid Metabolism in Mice |
title_full | Effects of Maternal Chromium Restriction on the Long-Term Programming in MAPK Signaling Pathway of Lipid Metabolism in Mice |
title_fullStr | Effects of Maternal Chromium Restriction on the Long-Term Programming in MAPK Signaling Pathway of Lipid Metabolism in Mice |
title_full_unstemmed | Effects of Maternal Chromium Restriction on the Long-Term Programming in MAPK Signaling Pathway of Lipid Metabolism in Mice |
title_short | Effects of Maternal Chromium Restriction on the Long-Term Programming in MAPK Signaling Pathway of Lipid Metabolism in Mice |
title_sort | effects of maternal chromium restriction on the long-term programming in mapk signaling pathway of lipid metabolism in mice |
topic | Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4997401/ https://www.ncbi.nlm.nih.gov/pubmed/27517955 http://dx.doi.org/10.3390/nu8080488 |
work_keys_str_mv | AT zhangqian effectsofmaternalchromiumrestrictiononthelongtermprogramminginmapksignalingpathwayoflipidmetabolisminmice AT sunxiaofang effectsofmaternalchromiumrestrictiononthelongtermprogramminginmapksignalingpathwayoflipidmetabolisminmice AT xiaoxinhua effectsofmaternalchromiumrestrictiononthelongtermprogramminginmapksignalingpathwayoflipidmetabolisminmice AT zhengjia effectsofmaternalchromiumrestrictiononthelongtermprogramminginmapksignalingpathwayoflipidmetabolisminmice AT liming effectsofmaternalchromiumrestrictiononthelongtermprogramminginmapksignalingpathwayoflipidmetabolisminmice AT yumiao effectsofmaternalchromiumrestrictiononthelongtermprogramminginmapksignalingpathwayoflipidmetabolisminmice AT pingfan effectsofmaternalchromiumrestrictiononthelongtermprogramminginmapksignalingpathwayoflipidmetabolisminmice AT wangzhixin effectsofmaternalchromiumrestrictiononthelongtermprogramminginmapksignalingpathwayoflipidmetabolisminmice AT qicuijuan effectsofmaternalchromiumrestrictiononthelongtermprogramminginmapksignalingpathwayoflipidmetabolisminmice AT wangtong effectsofmaternalchromiumrestrictiononthelongtermprogramminginmapksignalingpathwayoflipidmetabolisminmice AT wangxiaojing effectsofmaternalchromiumrestrictiononthelongtermprogramminginmapksignalingpathwayoflipidmetabolisminmice |