Cargando…

Population Genetics of the Endemic Hawaiian Species Chrysodracon hawaiiensis and Chrysodracon auwahiensis (Asparagaceae): Insights from RAPD and ISSR Variation

The genus Chrysodracon has six endemic species in the Hawaii Islands. Chrysodracon hawaiiensis is endemic to Hawaii Island and was described as a distinct species in 1980. It was listed as an endangered species on the International Union for the Conservation of Nature and Natural Resources (IUCN) Re...

Descripción completa

Detalles Bibliográficos
Autores principales: Lu, Pei-Luen, Yorkson, Mitsuko, Morden, Clifford W.
Formato: Online Artículo Texto
Lenguaje:English
Publicado: MDPI 2016
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5000738/
https://www.ncbi.nlm.nih.gov/pubmed/27537876
http://dx.doi.org/10.3390/ijms17081341
_version_ 1782450350839562240
author Lu, Pei-Luen
Yorkson, Mitsuko
Morden, Clifford W.
author_facet Lu, Pei-Luen
Yorkson, Mitsuko
Morden, Clifford W.
author_sort Lu, Pei-Luen
collection PubMed
description The genus Chrysodracon has six endemic species in the Hawaii Islands. Chrysodracon hawaiiensis is endemic to Hawaii Island and was described as a distinct species in 1980. It was listed as an endangered species on the International Union for the Conservation of Nature and Natural Resources (IUCN) Red List in 1997. This woody plant species was, at one time, common in exposed dry forests, but it became very rare due to grazing pressure and human development. The tree species Chrysodracon auwahiensis (C. auwahiensis), endemic to Maui and Molokai, still has large adult populations in dry lands of the islands, but unfortunately no regeneration from seed has been reported in those areas for many years. The two endemic species were examined using the molecular technique of random amplified polymorphic DNA (RAPD) and inter simple sequence repeats (ISSR) to determine the genetic structure of the populations and the amount of variation. Both species possess similar genetic structure. Larger and smaller populations of both species contain similar levels of genetic diversity as determined by the number of polymorphic loci, estimated heterozygosity, and Shannon’s index of genetic diversity. Although population diversity of Chrysodracon hawaiiensis (C. hawaiiensis) is thought to have remained near pre-disturbance levels, population size continues to decline as recruitment is either absent or does not keep pace with senescence of mature plants. Conservation recommendations for both species are suggested.
format Online
Article
Text
id pubmed-5000738
institution National Center for Biotechnology Information
language English
publishDate 2016
publisher MDPI
record_format MEDLINE/PubMed
spelling pubmed-50007382016-09-01 Population Genetics of the Endemic Hawaiian Species Chrysodracon hawaiiensis and Chrysodracon auwahiensis (Asparagaceae): Insights from RAPD and ISSR Variation Lu, Pei-Luen Yorkson, Mitsuko Morden, Clifford W. Int J Mol Sci Article The genus Chrysodracon has six endemic species in the Hawaii Islands. Chrysodracon hawaiiensis is endemic to Hawaii Island and was described as a distinct species in 1980. It was listed as an endangered species on the International Union for the Conservation of Nature and Natural Resources (IUCN) Red List in 1997. This woody plant species was, at one time, common in exposed dry forests, but it became very rare due to grazing pressure and human development. The tree species Chrysodracon auwahiensis (C. auwahiensis), endemic to Maui and Molokai, still has large adult populations in dry lands of the islands, but unfortunately no regeneration from seed has been reported in those areas for many years. The two endemic species were examined using the molecular technique of random amplified polymorphic DNA (RAPD) and inter simple sequence repeats (ISSR) to determine the genetic structure of the populations and the amount of variation. Both species possess similar genetic structure. Larger and smaller populations of both species contain similar levels of genetic diversity as determined by the number of polymorphic loci, estimated heterozygosity, and Shannon’s index of genetic diversity. Although population diversity of Chrysodracon hawaiiensis (C. hawaiiensis) is thought to have remained near pre-disturbance levels, population size continues to decline as recruitment is either absent or does not keep pace with senescence of mature plants. Conservation recommendations for both species are suggested. MDPI 2016-08-16 /pmc/articles/PMC5000738/ /pubmed/27537876 http://dx.doi.org/10.3390/ijms17081341 Text en © 2016 by the authors; licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC-BY) license (http://creativecommons.org/licenses/by/4.0/).
spellingShingle Article
Lu, Pei-Luen
Yorkson, Mitsuko
Morden, Clifford W.
Population Genetics of the Endemic Hawaiian Species Chrysodracon hawaiiensis and Chrysodracon auwahiensis (Asparagaceae): Insights from RAPD and ISSR Variation
title Population Genetics of the Endemic Hawaiian Species Chrysodracon hawaiiensis and Chrysodracon auwahiensis (Asparagaceae): Insights from RAPD and ISSR Variation
title_full Population Genetics of the Endemic Hawaiian Species Chrysodracon hawaiiensis and Chrysodracon auwahiensis (Asparagaceae): Insights from RAPD and ISSR Variation
title_fullStr Population Genetics of the Endemic Hawaiian Species Chrysodracon hawaiiensis and Chrysodracon auwahiensis (Asparagaceae): Insights from RAPD and ISSR Variation
title_full_unstemmed Population Genetics of the Endemic Hawaiian Species Chrysodracon hawaiiensis and Chrysodracon auwahiensis (Asparagaceae): Insights from RAPD and ISSR Variation
title_short Population Genetics of the Endemic Hawaiian Species Chrysodracon hawaiiensis and Chrysodracon auwahiensis (Asparagaceae): Insights from RAPD and ISSR Variation
title_sort population genetics of the endemic hawaiian species chrysodracon hawaiiensis and chrysodracon auwahiensis (asparagaceae): insights from rapd and issr variation
topic Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5000738/
https://www.ncbi.nlm.nih.gov/pubmed/27537876
http://dx.doi.org/10.3390/ijms17081341
work_keys_str_mv AT lupeiluen populationgeneticsoftheendemichawaiianspecieschrysodraconhawaiiensisandchrysodraconauwahiensisasparagaceaeinsightsfromrapdandissrvariation
AT yorksonmitsuko populationgeneticsoftheendemichawaiianspecieschrysodraconhawaiiensisandchrysodraconauwahiensisasparagaceaeinsightsfromrapdandissrvariation
AT mordencliffordw populationgeneticsoftheendemichawaiianspecieschrysodraconhawaiiensisandchrysodraconauwahiensisasparagaceaeinsightsfromrapdandissrvariation