Cargando…

Three year experience with the cochlear BAHA attract implant: a systematic review of the literature

BACKGROUND: Bone conduction devices are widely used and indicated in cases of conductive, mixed or single sided deafness where conventional hearing aids are not indicated or tolerated. Percutaneous bone-conduction devices gave satisfactory hearing outcomes but were frequently complicated by soft tis...

Descripción completa

Detalles Bibliográficos
Autores principales: Dimitriadis, Panagiotis A., Farr, Matthew R., Allam, Ahmed, Ray, Jaydip
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2016
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5045661/
https://www.ncbi.nlm.nih.gov/pubmed/27733813
http://dx.doi.org/10.1186/s12901-016-0033-5
_version_ 1782457162269720576
author Dimitriadis, Panagiotis A.
Farr, Matthew R.
Allam, Ahmed
Ray, Jaydip
author_facet Dimitriadis, Panagiotis A.
Farr, Matthew R.
Allam, Ahmed
Ray, Jaydip
author_sort Dimitriadis, Panagiotis A.
collection PubMed
description BACKGROUND: Bone conduction devices are widely used and indicated in cases of conductive, mixed or single sided deafness where conventional hearing aids are not indicated or tolerated. Percutaneous bone-conduction devices gave satisfactory hearing outcomes but were frequently complicated by soft tissue reactions. Transcutaneous bone conduction devices were developed in order to address some of the issues related to the skin-penetrating abutment. The aim of this article is to present a systematic review of the indications, surgical technique and audiological, clinical and functional outcomes of the BAHA Attract device reported so far. METHODS: A systematic computer-based literature search was performed on the PubMed database as well as Scopus, Cochrane and Google Scholar. Out of 497 articles, 10 studies and 89 reported cases were finally included in our review. RESULTS: The vast majority of implanted patients were satisfied with the aesthetics of the device scoring highly at the Abbreviated Profile of Hearing Aid Benefit, Glasgow Benefit Inventory and Client Oriented Scale of Improvement. Overall, hearing outcomes, tested by various means including speech in noise, free field hearing testing and word discrimination scores showed a significant improvement. Complications included seroma or haematoma formation, numbness around the area of the flap, swelling and detachment of the sound processor from the external magnet. CONCLUSIONS: The functional and audiological results presented so far in the literature have been satisfactory and the complication rate is low compared to the skin penetrating Bone Conduction Devices. Further robust trials will be needed to study the long-term outcomes and any adverse effects.
format Online
Article
Text
id pubmed-5045661
institution National Center for Biotechnology Information
language English
publishDate 2016
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-50456612016-10-12 Three year experience with the cochlear BAHA attract implant: a systematic review of the literature Dimitriadis, Panagiotis A. Farr, Matthew R. Allam, Ahmed Ray, Jaydip BMC Ear Nose Throat Disord Research Article BACKGROUND: Bone conduction devices are widely used and indicated in cases of conductive, mixed or single sided deafness where conventional hearing aids are not indicated or tolerated. Percutaneous bone-conduction devices gave satisfactory hearing outcomes but were frequently complicated by soft tissue reactions. Transcutaneous bone conduction devices were developed in order to address some of the issues related to the skin-penetrating abutment. The aim of this article is to present a systematic review of the indications, surgical technique and audiological, clinical and functional outcomes of the BAHA Attract device reported so far. METHODS: A systematic computer-based literature search was performed on the PubMed database as well as Scopus, Cochrane and Google Scholar. Out of 497 articles, 10 studies and 89 reported cases were finally included in our review. RESULTS: The vast majority of implanted patients were satisfied with the aesthetics of the device scoring highly at the Abbreviated Profile of Hearing Aid Benefit, Glasgow Benefit Inventory and Client Oriented Scale of Improvement. Overall, hearing outcomes, tested by various means including speech in noise, free field hearing testing and word discrimination scores showed a significant improvement. Complications included seroma or haematoma formation, numbness around the area of the flap, swelling and detachment of the sound processor from the external magnet. CONCLUSIONS: The functional and audiological results presented so far in the literature have been satisfactory and the complication rate is low compared to the skin penetrating Bone Conduction Devices. Further robust trials will be needed to study the long-term outcomes and any adverse effects. BioMed Central 2016-10-01 /pmc/articles/PMC5045661/ /pubmed/27733813 http://dx.doi.org/10.1186/s12901-016-0033-5 Text en © The Author(s). 2016 Open AccessThis article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated.
spellingShingle Research Article
Dimitriadis, Panagiotis A.
Farr, Matthew R.
Allam, Ahmed
Ray, Jaydip
Three year experience with the cochlear BAHA attract implant: a systematic review of the literature
title Three year experience with the cochlear BAHA attract implant: a systematic review of the literature
title_full Three year experience with the cochlear BAHA attract implant: a systematic review of the literature
title_fullStr Three year experience with the cochlear BAHA attract implant: a systematic review of the literature
title_full_unstemmed Three year experience with the cochlear BAHA attract implant: a systematic review of the literature
title_short Three year experience with the cochlear BAHA attract implant: a systematic review of the literature
title_sort three year experience with the cochlear baha attract implant: a systematic review of the literature
topic Research Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5045661/
https://www.ncbi.nlm.nih.gov/pubmed/27733813
http://dx.doi.org/10.1186/s12901-016-0033-5
work_keys_str_mv AT dimitriadispanagiotisa threeyearexperiencewiththecochlearbahaattractimplantasystematicreviewoftheliterature
AT farrmatthewr threeyearexperiencewiththecochlearbahaattractimplantasystematicreviewoftheliterature
AT allamahmed threeyearexperiencewiththecochlearbahaattractimplantasystematicreviewoftheliterature
AT rayjaydip threeyearexperiencewiththecochlearbahaattractimplantasystematicreviewoftheliterature