Cargando…
A randomized prospective controlled trial comparing the laryngeal tube suction disposable and the supreme laryngeal mask airway: the influence of head and neck position on oropharyngeal seal pressure
BACKGROUND: The Laryngeal Tube Suction Disposable (LTS-D) and the Supreme Laryngeal Mask Airway (SLMA) are second generation supraglottic airway devices (SADs) with an added channel to allow gastric drainage. We studied the efficacy of these devices when using pressure controlled mechanical ventilat...
Autores principales: | , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2016
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5054611/ https://www.ncbi.nlm.nih.gov/pubmed/27716165 http://dx.doi.org/10.1186/s12871-016-0237-7 |
_version_ | 1782458634399121408 |
---|---|
author | Somri, Mostafa Vaida, Sonia Fornari, Gustavo Garcia Mendoza, Gabriela Renee Charco-Mora, Pedro Hawash, Naser Matter, Ibrahim Swaid, Forat Gaitini, Luis |
author_facet | Somri, Mostafa Vaida, Sonia Fornari, Gustavo Garcia Mendoza, Gabriela Renee Charco-Mora, Pedro Hawash, Naser Matter, Ibrahim Swaid, Forat Gaitini, Luis |
author_sort | Somri, Mostafa |
collection | PubMed |
description | BACKGROUND: The Laryngeal Tube Suction Disposable (LTS-D) and the Supreme Laryngeal Mask Airway (SLMA) are second generation supraglottic airway devices (SADs) with an added channel to allow gastric drainage. We studied the efficacy of these devices when using pressure controlled mechanical ventilation during general anesthesia for short and medium duration surgical procedures and compared the oropharyngeal seal pressure in different head and-neck positions. METHODS: Eighty patients in each group had either LTS-D or SLMA for airway management. The patients were recruited in two different institutions. Primary outcome variables were the oropharyngeal seal pressures in neutral, flexion, extension, right and left head-neck position. Secondary outcome variables were time to achieve an effective airway, ease of insertion, number of attempts, maneuvers necessary during insertion, ventilatory parameters, success of gastric tube insertion and incidence of complications. RESULTS: The oropharyngeal seal pressure achieved with the LTS-D was higher than the SLMA in, (extension (p=0.0150) and right position (p=0.0268 at 60 cm H(2)O intracuff pressures and nearly significant in neutral position (p = 0.0571). The oropharyngeal seal pressure was significantly higher with the LTS-D during neck extension as compared to SLMA (p= 0.015). Similar oropharyngeal seal pressures were detected in all other positions with each device. The secondary outcomes were comparable between both groups. Patients ventilated with LTS-D had higher incidence of sore throat (p = 0.527). No major complications occurred. CONCLUSIONS: Better oropharyngeal seal pressure was achieved with the LTS-D in head-neck right and extension positions , although it did not appear to have significance in alteration of management using pressure control mechanical ventilation in neutral position. The fiberoptic view was better with the SLMA. The post-operative sore throat incidence was higher in the LTS-D. TRIAL REGISTRATION: ClinicalTrials.gov ID: NCT02856672, Unique Protocol ID:BnaiZionMC-16-LG-001, Registered: August 2016. |
format | Online Article Text |
id | pubmed-5054611 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2016 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-50546112016-10-19 A randomized prospective controlled trial comparing the laryngeal tube suction disposable and the supreme laryngeal mask airway: the influence of head and neck position on oropharyngeal seal pressure Somri, Mostafa Vaida, Sonia Fornari, Gustavo Garcia Mendoza, Gabriela Renee Charco-Mora, Pedro Hawash, Naser Matter, Ibrahim Swaid, Forat Gaitini, Luis BMC Anesthesiol Research Article BACKGROUND: The Laryngeal Tube Suction Disposable (LTS-D) and the Supreme Laryngeal Mask Airway (SLMA) are second generation supraglottic airway devices (SADs) with an added channel to allow gastric drainage. We studied the efficacy of these devices when using pressure controlled mechanical ventilation during general anesthesia for short and medium duration surgical procedures and compared the oropharyngeal seal pressure in different head and-neck positions. METHODS: Eighty patients in each group had either LTS-D or SLMA for airway management. The patients were recruited in two different institutions. Primary outcome variables were the oropharyngeal seal pressures in neutral, flexion, extension, right and left head-neck position. Secondary outcome variables were time to achieve an effective airway, ease of insertion, number of attempts, maneuvers necessary during insertion, ventilatory parameters, success of gastric tube insertion and incidence of complications. RESULTS: The oropharyngeal seal pressure achieved with the LTS-D was higher than the SLMA in, (extension (p=0.0150) and right position (p=0.0268 at 60 cm H(2)O intracuff pressures and nearly significant in neutral position (p = 0.0571). The oropharyngeal seal pressure was significantly higher with the LTS-D during neck extension as compared to SLMA (p= 0.015). Similar oropharyngeal seal pressures were detected in all other positions with each device. The secondary outcomes were comparable between both groups. Patients ventilated with LTS-D had higher incidence of sore throat (p = 0.527). No major complications occurred. CONCLUSIONS: Better oropharyngeal seal pressure was achieved with the LTS-D in head-neck right and extension positions , although it did not appear to have significance in alteration of management using pressure control mechanical ventilation in neutral position. The fiberoptic view was better with the SLMA. The post-operative sore throat incidence was higher in the LTS-D. TRIAL REGISTRATION: ClinicalTrials.gov ID: NCT02856672, Unique Protocol ID:BnaiZionMC-16-LG-001, Registered: August 2016. BioMed Central 2016-10-06 /pmc/articles/PMC5054611/ /pubmed/27716165 http://dx.doi.org/10.1186/s12871-016-0237-7 Text en © The Author(s). 2016 Open AccessThis article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated. |
spellingShingle | Research Article Somri, Mostafa Vaida, Sonia Fornari, Gustavo Garcia Mendoza, Gabriela Renee Charco-Mora, Pedro Hawash, Naser Matter, Ibrahim Swaid, Forat Gaitini, Luis A randomized prospective controlled trial comparing the laryngeal tube suction disposable and the supreme laryngeal mask airway: the influence of head and neck position on oropharyngeal seal pressure |
title | A randomized prospective controlled trial comparing the laryngeal tube suction disposable and the supreme laryngeal mask airway: the influence of head and neck position on oropharyngeal seal pressure |
title_full | A randomized prospective controlled trial comparing the laryngeal tube suction disposable and the supreme laryngeal mask airway: the influence of head and neck position on oropharyngeal seal pressure |
title_fullStr | A randomized prospective controlled trial comparing the laryngeal tube suction disposable and the supreme laryngeal mask airway: the influence of head and neck position on oropharyngeal seal pressure |
title_full_unstemmed | A randomized prospective controlled trial comparing the laryngeal tube suction disposable and the supreme laryngeal mask airway: the influence of head and neck position on oropharyngeal seal pressure |
title_short | A randomized prospective controlled trial comparing the laryngeal tube suction disposable and the supreme laryngeal mask airway: the influence of head and neck position on oropharyngeal seal pressure |
title_sort | randomized prospective controlled trial comparing the laryngeal tube suction disposable and the supreme laryngeal mask airway: the influence of head and neck position on oropharyngeal seal pressure |
topic | Research Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5054611/ https://www.ncbi.nlm.nih.gov/pubmed/27716165 http://dx.doi.org/10.1186/s12871-016-0237-7 |
work_keys_str_mv | AT somrimostafa arandomizedprospectivecontrolledtrialcomparingthelaryngealtubesuctiondisposableandthesupremelaryngealmaskairwaytheinfluenceofheadandneckpositiononoropharyngealsealpressure AT vaidasonia arandomizedprospectivecontrolledtrialcomparingthelaryngealtubesuctiondisposableandthesupremelaryngealmaskairwaytheinfluenceofheadandneckpositiononoropharyngealsealpressure AT fornarigustavogarcia arandomizedprospectivecontrolledtrialcomparingthelaryngealtubesuctiondisposableandthesupremelaryngealmaskairwaytheinfluenceofheadandneckpositiononoropharyngealsealpressure AT mendozagabrielarenee arandomizedprospectivecontrolledtrialcomparingthelaryngealtubesuctiondisposableandthesupremelaryngealmaskairwaytheinfluenceofheadandneckpositiononoropharyngealsealpressure AT charcomorapedro arandomizedprospectivecontrolledtrialcomparingthelaryngealtubesuctiondisposableandthesupremelaryngealmaskairwaytheinfluenceofheadandneckpositiononoropharyngealsealpressure AT hawashnaser arandomizedprospectivecontrolledtrialcomparingthelaryngealtubesuctiondisposableandthesupremelaryngealmaskairwaytheinfluenceofheadandneckpositiononoropharyngealsealpressure AT matteribrahim arandomizedprospectivecontrolledtrialcomparingthelaryngealtubesuctiondisposableandthesupremelaryngealmaskairwaytheinfluenceofheadandneckpositiononoropharyngealsealpressure AT swaidforat arandomizedprospectivecontrolledtrialcomparingthelaryngealtubesuctiondisposableandthesupremelaryngealmaskairwaytheinfluenceofheadandneckpositiononoropharyngealsealpressure AT gaitiniluis arandomizedprospectivecontrolledtrialcomparingthelaryngealtubesuctiondisposableandthesupremelaryngealmaskairwaytheinfluenceofheadandneckpositiononoropharyngealsealpressure AT somrimostafa randomizedprospectivecontrolledtrialcomparingthelaryngealtubesuctiondisposableandthesupremelaryngealmaskairwaytheinfluenceofheadandneckpositiononoropharyngealsealpressure AT vaidasonia randomizedprospectivecontrolledtrialcomparingthelaryngealtubesuctiondisposableandthesupremelaryngealmaskairwaytheinfluenceofheadandneckpositiononoropharyngealsealpressure AT fornarigustavogarcia randomizedprospectivecontrolledtrialcomparingthelaryngealtubesuctiondisposableandthesupremelaryngealmaskairwaytheinfluenceofheadandneckpositiononoropharyngealsealpressure AT mendozagabrielarenee randomizedprospectivecontrolledtrialcomparingthelaryngealtubesuctiondisposableandthesupremelaryngealmaskairwaytheinfluenceofheadandneckpositiononoropharyngealsealpressure AT charcomorapedro randomizedprospectivecontrolledtrialcomparingthelaryngealtubesuctiondisposableandthesupremelaryngealmaskairwaytheinfluenceofheadandneckpositiononoropharyngealsealpressure AT hawashnaser randomizedprospectivecontrolledtrialcomparingthelaryngealtubesuctiondisposableandthesupremelaryngealmaskairwaytheinfluenceofheadandneckpositiononoropharyngealsealpressure AT matteribrahim randomizedprospectivecontrolledtrialcomparingthelaryngealtubesuctiondisposableandthesupremelaryngealmaskairwaytheinfluenceofheadandneckpositiononoropharyngealsealpressure AT swaidforat randomizedprospectivecontrolledtrialcomparingthelaryngealtubesuctiondisposableandthesupremelaryngealmaskairwaytheinfluenceofheadandneckpositiononoropharyngealsealpressure AT gaitiniluis randomizedprospectivecontrolledtrialcomparingthelaryngealtubesuctiondisposableandthesupremelaryngealmaskairwaytheinfluenceofheadandneckpositiononoropharyngealsealpressure |