Cargando…
cAMP-PKA-CaMKII signaling pathway is involved in aggravated cardiotoxicity during Fuzi and Beimu Combination Treatment of Experimental Pulmonary Hypertension
Aconiti Lateralis Radix Praeparata (Fuzi) and Fritillariae Thunbergii bulbus (Beimu) have been widely used clinically to treat cardiopulmonary related diseases in China. However, according to the classic rules of traditional Chinese medicine, Fuzi and Beimu should be prohibited to use as a combinati...
Autores principales: | , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Nature Publishing Group
2016
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5064387/ https://www.ncbi.nlm.nih.gov/pubmed/27739450 http://dx.doi.org/10.1038/srep34903 |
_version_ | 1782460151064690688 |
---|---|
author | Zhuang, Pengwei Huang, Yingying Lu, Zhiqiang Yang, Zhen Xu, Liman Sun, Fengjiao Zhang, Yanjun Duan, Jinao |
author_facet | Zhuang, Pengwei Huang, Yingying Lu, Zhiqiang Yang, Zhen Xu, Liman Sun, Fengjiao Zhang, Yanjun Duan, Jinao |
author_sort | Zhuang, Pengwei |
collection | PubMed |
description | Aconiti Lateralis Radix Praeparata (Fuzi) and Fritillariae Thunbergii bulbus (Beimu) have been widely used clinically to treat cardiopulmonary related diseases in China. However, according to the classic rules of traditional Chinese medicine, Fuzi and Beimu should be prohibited to use as a combination for their incompatibility. Therefore, it is critical to elucidate the paradox on the use of Fuzi and Beimu combination therapy. Monocrotaline-induced pulmonary hypertension rats were treated with either Fuzi, Beimu, or their combination at different stages of PH. We demonstrated that at the early stage of PH, Fuzi and Beimu combination significantly improved lung function and reduced pulmonary histopathology. However, as the disease progressed, when Fuzi and Beimu combination were used at the late stage of PH, right ventricular chamber dilation was histologically apparent and myocardial apoptosis was significantly increased compared with each drug alone. Western-blotting results indicated that the main chemical ingredient of Beimu could down-regulate the protein phosphorylation levels of Akt and PDE4D, whereas the combination of Fuzi and Beimu could up-regulate PKA and CaMKII signaling pathways. Therefore, we concluded that Fuzi and Beimu combination potentially aggravated the heart injury due to the inhibition of PDK1/Akt/PDE4D axis and subsequent synergistic activation of βAR-Gs-PKA/CaMKII signaling pathway. |
format | Online Article Text |
id | pubmed-5064387 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2016 |
publisher | Nature Publishing Group |
record_format | MEDLINE/PubMed |
spelling | pubmed-50643872016-10-26 cAMP-PKA-CaMKII signaling pathway is involved in aggravated cardiotoxicity during Fuzi and Beimu Combination Treatment of Experimental Pulmonary Hypertension Zhuang, Pengwei Huang, Yingying Lu, Zhiqiang Yang, Zhen Xu, Liman Sun, Fengjiao Zhang, Yanjun Duan, Jinao Sci Rep Article Aconiti Lateralis Radix Praeparata (Fuzi) and Fritillariae Thunbergii bulbus (Beimu) have been widely used clinically to treat cardiopulmonary related diseases in China. However, according to the classic rules of traditional Chinese medicine, Fuzi and Beimu should be prohibited to use as a combination for their incompatibility. Therefore, it is critical to elucidate the paradox on the use of Fuzi and Beimu combination therapy. Monocrotaline-induced pulmonary hypertension rats were treated with either Fuzi, Beimu, or their combination at different stages of PH. We demonstrated that at the early stage of PH, Fuzi and Beimu combination significantly improved lung function and reduced pulmonary histopathology. However, as the disease progressed, when Fuzi and Beimu combination were used at the late stage of PH, right ventricular chamber dilation was histologically apparent and myocardial apoptosis was significantly increased compared with each drug alone. Western-blotting results indicated that the main chemical ingredient of Beimu could down-regulate the protein phosphorylation levels of Akt and PDE4D, whereas the combination of Fuzi and Beimu could up-regulate PKA and CaMKII signaling pathways. Therefore, we concluded that Fuzi and Beimu combination potentially aggravated the heart injury due to the inhibition of PDK1/Akt/PDE4D axis and subsequent synergistic activation of βAR-Gs-PKA/CaMKII signaling pathway. Nature Publishing Group 2016-10-14 /pmc/articles/PMC5064387/ /pubmed/27739450 http://dx.doi.org/10.1038/srep34903 Text en Copyright © 2016, The Author(s) http://creativecommons.org/licenses/by/4.0/ This work is licensed under a Creative Commons Attribution 4.0 International License. The images or other third party material in this article are included in the article’s Creative Commons license, unless indicated otherwise in the credit line; if the material is not included under the Creative Commons license, users will need to obtain permission from the license holder to reproduce the material. To view a copy of this license, visit http://creativecommons.org/licenses/by/4.0/ |
spellingShingle | Article Zhuang, Pengwei Huang, Yingying Lu, Zhiqiang Yang, Zhen Xu, Liman Sun, Fengjiao Zhang, Yanjun Duan, Jinao cAMP-PKA-CaMKII signaling pathway is involved in aggravated cardiotoxicity during Fuzi and Beimu Combination Treatment of Experimental Pulmonary Hypertension |
title | cAMP-PKA-CaMKII signaling pathway is involved in aggravated cardiotoxicity during Fuzi and Beimu Combination Treatment of Experimental Pulmonary Hypertension |
title_full | cAMP-PKA-CaMKII signaling pathway is involved in aggravated cardiotoxicity during Fuzi and Beimu Combination Treatment of Experimental Pulmonary Hypertension |
title_fullStr | cAMP-PKA-CaMKII signaling pathway is involved in aggravated cardiotoxicity during Fuzi and Beimu Combination Treatment of Experimental Pulmonary Hypertension |
title_full_unstemmed | cAMP-PKA-CaMKII signaling pathway is involved in aggravated cardiotoxicity during Fuzi and Beimu Combination Treatment of Experimental Pulmonary Hypertension |
title_short | cAMP-PKA-CaMKII signaling pathway is involved in aggravated cardiotoxicity during Fuzi and Beimu Combination Treatment of Experimental Pulmonary Hypertension |
title_sort | camp-pka-camkii signaling pathway is involved in aggravated cardiotoxicity during fuzi and beimu combination treatment of experimental pulmonary hypertension |
topic | Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5064387/ https://www.ncbi.nlm.nih.gov/pubmed/27739450 http://dx.doi.org/10.1038/srep34903 |
work_keys_str_mv | AT zhuangpengwei camppkacamkiisignalingpathwayisinvolvedinaggravatedcardiotoxicityduringfuziandbeimucombinationtreatmentofexperimentalpulmonaryhypertension AT huangyingying camppkacamkiisignalingpathwayisinvolvedinaggravatedcardiotoxicityduringfuziandbeimucombinationtreatmentofexperimentalpulmonaryhypertension AT luzhiqiang camppkacamkiisignalingpathwayisinvolvedinaggravatedcardiotoxicityduringfuziandbeimucombinationtreatmentofexperimentalpulmonaryhypertension AT yangzhen camppkacamkiisignalingpathwayisinvolvedinaggravatedcardiotoxicityduringfuziandbeimucombinationtreatmentofexperimentalpulmonaryhypertension AT xuliman camppkacamkiisignalingpathwayisinvolvedinaggravatedcardiotoxicityduringfuziandbeimucombinationtreatmentofexperimentalpulmonaryhypertension AT sunfengjiao camppkacamkiisignalingpathwayisinvolvedinaggravatedcardiotoxicityduringfuziandbeimucombinationtreatmentofexperimentalpulmonaryhypertension AT zhangyanjun camppkacamkiisignalingpathwayisinvolvedinaggravatedcardiotoxicityduringfuziandbeimucombinationtreatmentofexperimentalpulmonaryhypertension AT duanjinao camppkacamkiisignalingpathwayisinvolvedinaggravatedcardiotoxicityduringfuziandbeimucombinationtreatmentofexperimentalpulmonaryhypertension |