Cargando…
Coronary Artery Aneurysms in Kawasaki Disease: Risk Factors for Progressive Disease and Adverse Cardiac Events in the US Population
BACKGROUND: The natural history of coronary artery aneurysms (CAA) after intravenous immunoglobulin (IVIG) treatment in the United States is not well described. We describe the natural history of CAA in US Kawasaki disease (KD) patients and identify factors associated with major adverse cardiac even...
Autores principales: | , , , , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
John Wiley and Sons Inc.
2016
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5079009/ https://www.ncbi.nlm.nih.gov/pubmed/27633390 http://dx.doi.org/10.1161/JAHA.116.003289 |
_version_ | 1782462496556187648 |
---|---|
author | Friedman, Kevin G. Gauvreau, Kimberly Hamaoka‐Okamoto, Akiko Tang, Alexander Berry, Erika Tremoulet, Adriana H. Mahavadi, Vidya S. Baker, Annette deFerranti, Sarah D. Fulton, David R. Burns, Jane C. Newburger, Jane W. |
author_facet | Friedman, Kevin G. Gauvreau, Kimberly Hamaoka‐Okamoto, Akiko Tang, Alexander Berry, Erika Tremoulet, Adriana H. Mahavadi, Vidya S. Baker, Annette deFerranti, Sarah D. Fulton, David R. Burns, Jane C. Newburger, Jane W. |
author_sort | Friedman, Kevin G. |
collection | PubMed |
description | BACKGROUND: The natural history of coronary artery aneurysms (CAA) after intravenous immunoglobulin (IVIG) treatment in the United States is not well described. We describe the natural history of CAA in US Kawasaki disease (KD) patients and identify factors associated with major adverse cardiac events (MACE) and CAA regression. METHODS AND RESULTS: We evaluated all KD patients with CAA at 2 centers from 1979 to 2014. Factors associated with CAA regression, maximum CA z‐score over time (zMax), and MACE were analyzed. We performed a matched analysis of treatment effect on likelihood of CAA regression. Of 2860 KD patients, 500 (17%) had CAA, including 90 with CAA z‐score >10. Most (91%) received IVIG within 10 days of illness, 32% received >1 IVIG, and 27% received adjunctive anti‐inflammatory medications. CAA regression occurred in 75%. Lack of CAA regression and higher CAA zMax were associated with earlier era, larger CAA z‐score at diagnosis, and bilateral CAA in univariate and multivariable analyses. MACE occurred in 24 (5%) patients and was associated with higher CAA z‐score at diagnosis and lack of IVIG treatment. In a subset of patients (n=132) matched by age at KD and baseline CAA z‐score, those receiving IVIG plus adjunctive medication had a CAA regression rate of 91% compared with 68% for the 3 other groups (IVIG alone, IVIG ≥2 doses, or IVIG ≥2 doses plus adjunctive medication). CONCLUSIONS: CAA regression occurred in 75% of patients. CAA z‐score at diagnosis was highly predictive of outcomes, which may be improved by early IVIG treatment and adjunctive therapies. |
format | Online Article Text |
id | pubmed-5079009 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2016 |
publisher | John Wiley and Sons Inc. |
record_format | MEDLINE/PubMed |
spelling | pubmed-50790092016-10-28 Coronary Artery Aneurysms in Kawasaki Disease: Risk Factors for Progressive Disease and Adverse Cardiac Events in the US Population Friedman, Kevin G. Gauvreau, Kimberly Hamaoka‐Okamoto, Akiko Tang, Alexander Berry, Erika Tremoulet, Adriana H. Mahavadi, Vidya S. Baker, Annette deFerranti, Sarah D. Fulton, David R. Burns, Jane C. Newburger, Jane W. J Am Heart Assoc Original Research BACKGROUND: The natural history of coronary artery aneurysms (CAA) after intravenous immunoglobulin (IVIG) treatment in the United States is not well described. We describe the natural history of CAA in US Kawasaki disease (KD) patients and identify factors associated with major adverse cardiac events (MACE) and CAA regression. METHODS AND RESULTS: We evaluated all KD patients with CAA at 2 centers from 1979 to 2014. Factors associated with CAA regression, maximum CA z‐score over time (zMax), and MACE were analyzed. We performed a matched analysis of treatment effect on likelihood of CAA regression. Of 2860 KD patients, 500 (17%) had CAA, including 90 with CAA z‐score >10. Most (91%) received IVIG within 10 days of illness, 32% received >1 IVIG, and 27% received adjunctive anti‐inflammatory medications. CAA regression occurred in 75%. Lack of CAA regression and higher CAA zMax were associated with earlier era, larger CAA z‐score at diagnosis, and bilateral CAA in univariate and multivariable analyses. MACE occurred in 24 (5%) patients and was associated with higher CAA z‐score at diagnosis and lack of IVIG treatment. In a subset of patients (n=132) matched by age at KD and baseline CAA z‐score, those receiving IVIG plus adjunctive medication had a CAA regression rate of 91% compared with 68% for the 3 other groups (IVIG alone, IVIG ≥2 doses, or IVIG ≥2 doses plus adjunctive medication). CONCLUSIONS: CAA regression occurred in 75% of patients. CAA z‐score at diagnosis was highly predictive of outcomes, which may be improved by early IVIG treatment and adjunctive therapies. John Wiley and Sons Inc. 2016-09-15 /pmc/articles/PMC5079009/ /pubmed/27633390 http://dx.doi.org/10.1161/JAHA.116.003289 Text en © 2016 The Authors. Published on behalf of the American Heart Association, Inc., by Wiley Blackwell. This is an open access article under the terms of the Creative Commons Attribution‐NonCommercial‐NoDerivs (http://creativecommons.org/licenses/by-nc-nd/4.0/) License, which permits use and distribution in any medium, provided the original work is properly cited, the use is non‐commercial and no modifications or adaptations are made. |
spellingShingle | Original Research Friedman, Kevin G. Gauvreau, Kimberly Hamaoka‐Okamoto, Akiko Tang, Alexander Berry, Erika Tremoulet, Adriana H. Mahavadi, Vidya S. Baker, Annette deFerranti, Sarah D. Fulton, David R. Burns, Jane C. Newburger, Jane W. Coronary Artery Aneurysms in Kawasaki Disease: Risk Factors for Progressive Disease and Adverse Cardiac Events in the US Population |
title | Coronary Artery Aneurysms in Kawasaki Disease: Risk Factors for Progressive Disease and Adverse Cardiac Events in the US Population |
title_full | Coronary Artery Aneurysms in Kawasaki Disease: Risk Factors for Progressive Disease and Adverse Cardiac Events in the US Population |
title_fullStr | Coronary Artery Aneurysms in Kawasaki Disease: Risk Factors for Progressive Disease and Adverse Cardiac Events in the US Population |
title_full_unstemmed | Coronary Artery Aneurysms in Kawasaki Disease: Risk Factors for Progressive Disease and Adverse Cardiac Events in the US Population |
title_short | Coronary Artery Aneurysms in Kawasaki Disease: Risk Factors for Progressive Disease and Adverse Cardiac Events in the US Population |
title_sort | coronary artery aneurysms in kawasaki disease: risk factors for progressive disease and adverse cardiac events in the us population |
topic | Original Research |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5079009/ https://www.ncbi.nlm.nih.gov/pubmed/27633390 http://dx.doi.org/10.1161/JAHA.116.003289 |
work_keys_str_mv | AT friedmankeving coronaryarteryaneurysmsinkawasakidiseaseriskfactorsforprogressivediseaseandadversecardiaceventsintheuspopulation AT gauvreaukimberly coronaryarteryaneurysmsinkawasakidiseaseriskfactorsforprogressivediseaseandadversecardiaceventsintheuspopulation AT hamaokaokamotoakiko coronaryarteryaneurysmsinkawasakidiseaseriskfactorsforprogressivediseaseandadversecardiaceventsintheuspopulation AT tangalexander coronaryarteryaneurysmsinkawasakidiseaseriskfactorsforprogressivediseaseandadversecardiaceventsintheuspopulation AT berryerika coronaryarteryaneurysmsinkawasakidiseaseriskfactorsforprogressivediseaseandadversecardiaceventsintheuspopulation AT tremouletadrianah coronaryarteryaneurysmsinkawasakidiseaseriskfactorsforprogressivediseaseandadversecardiaceventsintheuspopulation AT mahavadividyas coronaryarteryaneurysmsinkawasakidiseaseriskfactorsforprogressivediseaseandadversecardiaceventsintheuspopulation AT bakerannette coronaryarteryaneurysmsinkawasakidiseaseriskfactorsforprogressivediseaseandadversecardiaceventsintheuspopulation AT deferrantisarahd coronaryarteryaneurysmsinkawasakidiseaseriskfactorsforprogressivediseaseandadversecardiaceventsintheuspopulation AT fultondavidr coronaryarteryaneurysmsinkawasakidiseaseriskfactorsforprogressivediseaseandadversecardiaceventsintheuspopulation AT burnsjanec coronaryarteryaneurysmsinkawasakidiseaseriskfactorsforprogressivediseaseandadversecardiaceventsintheuspopulation AT newburgerjanew coronaryarteryaneurysmsinkawasakidiseaseriskfactorsforprogressivediseaseandadversecardiaceventsintheuspopulation |