Cargando…
A novel COL4A1 frameshift mutation in familial kidney disease: the importance of the C-terminal NC1 domain of type IV collagen
BACKGROUND: Hereditary microscopic haematuria often segregates with mutations of COL4A3, COL4A4 or COL4A5 but in half of families a gene is not identified. We investigated a Cypriot family with autosomal dominant microscopic haematuria with renal failure and kidney cysts. METHODS: We used genome-wid...
Autores principales: | , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Oxford University Press
2016
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5091614/ https://www.ncbi.nlm.nih.gov/pubmed/27190376 http://dx.doi.org/10.1093/ndt/gfw051 |
_version_ | 1782464615874035712 |
---|---|
author | Gale, Daniel P. Oygar, D. Deren Lin, Fujun Oygar, P. Derin Khan, Nadia Connor, Thomas M.F. Lapsley, Marta Maxwell, Patrick H. Neild, Guy H. |
author_facet | Gale, Daniel P. Oygar, D. Deren Lin, Fujun Oygar, P. Derin Khan, Nadia Connor, Thomas M.F. Lapsley, Marta Maxwell, Patrick H. Neild, Guy H. |
author_sort | Gale, Daniel P. |
collection | PubMed |
description | BACKGROUND: Hereditary microscopic haematuria often segregates with mutations of COL4A3, COL4A4 or COL4A5 but in half of families a gene is not identified. We investigated a Cypriot family with autosomal dominant microscopic haematuria with renal failure and kidney cysts. METHODS: We used genome-wide linkage analysis, whole exome sequencing and cosegregation analyses. RESULTS: We identified a novel frameshift mutation, c.4611_4612insG:p.T1537fs, in exon 49 of COL4A1. This mutation predicts truncation of the protein with disruption of the C-terminal part of the NC1 domain. We confirmed its presence in 20 family members, 17 with confirmed haematuria, 5 of whom also had stage 4 or 5 chronic kidney disease. Eleven family members exhibited kidney cysts (55% of those with the mutation), but muscle cramps or cerebral aneurysms were not observed and serum creatine kinase was normal in all individuals tested. CONCLUSIONS: Missense mutations of COL4A1 that encode the CB3 [IV] segment of the triple helical domain (exons 24 and 25) are associated with HANAC syndrome (hereditary angiopathy, nephropathy, aneurysms and cramps). Missense mutations of COL4A1 that disrupt the NC1 domain are associated with antenatal cerebral haemorrhage and porencephaly, but not kidney disease. Our findings extend the spectrum of COL4A1 mutations linked with renal disease and demonstrate that the highly conserved C-terminal part of the NC1 domain of the α1 chain of type IV collagen is important in the integrity of glomerular basement membrane in humans. |
format | Online Article Text |
id | pubmed-5091614 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2016 |
publisher | Oxford University Press |
record_format | MEDLINE/PubMed |
spelling | pubmed-50916142016-11-03 A novel COL4A1 frameshift mutation in familial kidney disease: the importance of the C-terminal NC1 domain of type IV collagen Gale, Daniel P. Oygar, D. Deren Lin, Fujun Oygar, P. Derin Khan, Nadia Connor, Thomas M.F. Lapsley, Marta Maxwell, Patrick H. Neild, Guy H. Nephrol Dial Transplant CLINICAL SCIENCE BACKGROUND: Hereditary microscopic haematuria often segregates with mutations of COL4A3, COL4A4 or COL4A5 but in half of families a gene is not identified. We investigated a Cypriot family with autosomal dominant microscopic haematuria with renal failure and kidney cysts. METHODS: We used genome-wide linkage analysis, whole exome sequencing and cosegregation analyses. RESULTS: We identified a novel frameshift mutation, c.4611_4612insG:p.T1537fs, in exon 49 of COL4A1. This mutation predicts truncation of the protein with disruption of the C-terminal part of the NC1 domain. We confirmed its presence in 20 family members, 17 with confirmed haematuria, 5 of whom also had stage 4 or 5 chronic kidney disease. Eleven family members exhibited kidney cysts (55% of those with the mutation), but muscle cramps or cerebral aneurysms were not observed and serum creatine kinase was normal in all individuals tested. CONCLUSIONS: Missense mutations of COL4A1 that encode the CB3 [IV] segment of the triple helical domain (exons 24 and 25) are associated with HANAC syndrome (hereditary angiopathy, nephropathy, aneurysms and cramps). Missense mutations of COL4A1 that disrupt the NC1 domain are associated with antenatal cerebral haemorrhage and porencephaly, but not kidney disease. Our findings extend the spectrum of COL4A1 mutations linked with renal disease and demonstrate that the highly conserved C-terminal part of the NC1 domain of the α1 chain of type IV collagen is important in the integrity of glomerular basement membrane in humans. Oxford University Press 2016-11 2016-04-08 /pmc/articles/PMC5091614/ /pubmed/27190376 http://dx.doi.org/10.1093/ndt/gfw051 Text en © The Author 2016. Published by Oxford University Press on behalf of ERA-EDTA. http://creativecommons.org/licenses/by/4.0/ This is an Open Access article distributed under the terms of the Creative Commons Attribution License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted reuse, distribution, and reproduction in any medium, provided the original work is properly cited. |
spellingShingle | CLINICAL SCIENCE Gale, Daniel P. Oygar, D. Deren Lin, Fujun Oygar, P. Derin Khan, Nadia Connor, Thomas M.F. Lapsley, Marta Maxwell, Patrick H. Neild, Guy H. A novel COL4A1 frameshift mutation in familial kidney disease: the importance of the C-terminal NC1 domain of type IV collagen |
title | A novel COL4A1 frameshift mutation in familial kidney disease: the importance of the C-terminal NC1 domain of type IV collagen |
title_full | A novel COL4A1 frameshift mutation in familial kidney disease: the importance of the C-terminal NC1 domain of type IV collagen |
title_fullStr | A novel COL4A1 frameshift mutation in familial kidney disease: the importance of the C-terminal NC1 domain of type IV collagen |
title_full_unstemmed | A novel COL4A1 frameshift mutation in familial kidney disease: the importance of the C-terminal NC1 domain of type IV collagen |
title_short | A novel COL4A1 frameshift mutation in familial kidney disease: the importance of the C-terminal NC1 domain of type IV collagen |
title_sort | novel col4a1 frameshift mutation in familial kidney disease: the importance of the c-terminal nc1 domain of type iv collagen |
topic | CLINICAL SCIENCE |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5091614/ https://www.ncbi.nlm.nih.gov/pubmed/27190376 http://dx.doi.org/10.1093/ndt/gfw051 |
work_keys_str_mv | AT galedanielp anovelcol4a1frameshiftmutationinfamilialkidneydiseasetheimportanceofthecterminalnc1domainoftypeivcollagen AT oygardderen anovelcol4a1frameshiftmutationinfamilialkidneydiseasetheimportanceofthecterminalnc1domainoftypeivcollagen AT linfujun anovelcol4a1frameshiftmutationinfamilialkidneydiseasetheimportanceofthecterminalnc1domainoftypeivcollagen AT oygarpderin anovelcol4a1frameshiftmutationinfamilialkidneydiseasetheimportanceofthecterminalnc1domainoftypeivcollagen AT khannadia anovelcol4a1frameshiftmutationinfamilialkidneydiseasetheimportanceofthecterminalnc1domainoftypeivcollagen AT connorthomasmf anovelcol4a1frameshiftmutationinfamilialkidneydiseasetheimportanceofthecterminalnc1domainoftypeivcollagen AT lapsleymarta anovelcol4a1frameshiftmutationinfamilialkidneydiseasetheimportanceofthecterminalnc1domainoftypeivcollagen AT maxwellpatrickh anovelcol4a1frameshiftmutationinfamilialkidneydiseasetheimportanceofthecterminalnc1domainoftypeivcollagen AT neildguyh anovelcol4a1frameshiftmutationinfamilialkidneydiseasetheimportanceofthecterminalnc1domainoftypeivcollagen AT galedanielp novelcol4a1frameshiftmutationinfamilialkidneydiseasetheimportanceofthecterminalnc1domainoftypeivcollagen AT oygardderen novelcol4a1frameshiftmutationinfamilialkidneydiseasetheimportanceofthecterminalnc1domainoftypeivcollagen AT linfujun novelcol4a1frameshiftmutationinfamilialkidneydiseasetheimportanceofthecterminalnc1domainoftypeivcollagen AT oygarpderin novelcol4a1frameshiftmutationinfamilialkidneydiseasetheimportanceofthecterminalnc1domainoftypeivcollagen AT khannadia novelcol4a1frameshiftmutationinfamilialkidneydiseasetheimportanceofthecterminalnc1domainoftypeivcollagen AT connorthomasmf novelcol4a1frameshiftmutationinfamilialkidneydiseasetheimportanceofthecterminalnc1domainoftypeivcollagen AT lapsleymarta novelcol4a1frameshiftmutationinfamilialkidneydiseasetheimportanceofthecterminalnc1domainoftypeivcollagen AT maxwellpatrickh novelcol4a1frameshiftmutationinfamilialkidneydiseasetheimportanceofthecterminalnc1domainoftypeivcollagen AT neildguyh novelcol4a1frameshiftmutationinfamilialkidneydiseasetheimportanceofthecterminalnc1domainoftypeivcollagen |