Cargando…

A novel COL4A1 frameshift mutation in familial kidney disease: the importance of the C-terminal NC1 domain of type IV collagen

BACKGROUND: Hereditary microscopic haematuria often segregates with mutations of COL4A3, COL4A4 or COL4A5 but in half of families a gene is not identified. We investigated a Cypriot family with autosomal dominant microscopic haematuria with renal failure and kidney cysts. METHODS: We used genome-wid...

Descripción completa

Detalles Bibliográficos
Autores principales: Gale, Daniel P., Oygar, D. Deren, Lin, Fujun, Oygar, P. Derin, Khan, Nadia, Connor, Thomas M.F., Lapsley, Marta, Maxwell, Patrick H., Neild, Guy H.
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Oxford University Press 2016
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5091614/
https://www.ncbi.nlm.nih.gov/pubmed/27190376
http://dx.doi.org/10.1093/ndt/gfw051
_version_ 1782464615874035712
author Gale, Daniel P.
Oygar, D. Deren
Lin, Fujun
Oygar, P. Derin
Khan, Nadia
Connor, Thomas M.F.
Lapsley, Marta
Maxwell, Patrick H.
Neild, Guy H.
author_facet Gale, Daniel P.
Oygar, D. Deren
Lin, Fujun
Oygar, P. Derin
Khan, Nadia
Connor, Thomas M.F.
Lapsley, Marta
Maxwell, Patrick H.
Neild, Guy H.
author_sort Gale, Daniel P.
collection PubMed
description BACKGROUND: Hereditary microscopic haematuria often segregates with mutations of COL4A3, COL4A4 or COL4A5 but in half of families a gene is not identified. We investigated a Cypriot family with autosomal dominant microscopic haematuria with renal failure and kidney cysts. METHODS: We used genome-wide linkage analysis, whole exome sequencing and cosegregation analyses. RESULTS: We identified a novel frameshift mutation, c.4611_4612insG:p.T1537fs, in exon 49 of COL4A1. This mutation predicts truncation of the protein with disruption of the C-terminal part of the NC1 domain. We confirmed its presence in 20 family members, 17 with confirmed haematuria, 5 of whom also had stage 4 or 5 chronic kidney disease. Eleven family members exhibited kidney cysts (55% of those with the mutation), but muscle cramps or cerebral aneurysms were not observed and serum creatine kinase was normal in all individuals tested. CONCLUSIONS: Missense mutations of COL4A1 that encode the CB3 [IV] segment of the triple helical domain (exons 24 and 25) are associated with HANAC syndrome (hereditary angiopathy, nephropathy, aneurysms and cramps). Missense mutations of COL4A1 that disrupt the NC1 domain are associated with antenatal cerebral haemorrhage and porencephaly, but not kidney disease. Our findings extend the spectrum of COL4A1 mutations linked with renal disease and demonstrate that the highly conserved C-terminal part of the NC1 domain of the α1 chain of type IV collagen is important in the integrity of glomerular basement membrane in humans.
format Online
Article
Text
id pubmed-5091614
institution National Center for Biotechnology Information
language English
publishDate 2016
publisher Oxford University Press
record_format MEDLINE/PubMed
spelling pubmed-50916142016-11-03 A novel COL4A1 frameshift mutation in familial kidney disease: the importance of the C-terminal NC1 domain of type IV collagen Gale, Daniel P. Oygar, D. Deren Lin, Fujun Oygar, P. Derin Khan, Nadia Connor, Thomas M.F. Lapsley, Marta Maxwell, Patrick H. Neild, Guy H. Nephrol Dial Transplant CLINICAL SCIENCE BACKGROUND: Hereditary microscopic haematuria often segregates with mutations of COL4A3, COL4A4 or COL4A5 but in half of families a gene is not identified. We investigated a Cypriot family with autosomal dominant microscopic haematuria with renal failure and kidney cysts. METHODS: We used genome-wide linkage analysis, whole exome sequencing and cosegregation analyses. RESULTS: We identified a novel frameshift mutation, c.4611_4612insG:p.T1537fs, in exon 49 of COL4A1. This mutation predicts truncation of the protein with disruption of the C-terminal part of the NC1 domain. We confirmed its presence in 20 family members, 17 with confirmed haematuria, 5 of whom also had stage 4 or 5 chronic kidney disease. Eleven family members exhibited kidney cysts (55% of those with the mutation), but muscle cramps or cerebral aneurysms were not observed and serum creatine kinase was normal in all individuals tested. CONCLUSIONS: Missense mutations of COL4A1 that encode the CB3 [IV] segment of the triple helical domain (exons 24 and 25) are associated with HANAC syndrome (hereditary angiopathy, nephropathy, aneurysms and cramps). Missense mutations of COL4A1 that disrupt the NC1 domain are associated with antenatal cerebral haemorrhage and porencephaly, but not kidney disease. Our findings extend the spectrum of COL4A1 mutations linked with renal disease and demonstrate that the highly conserved C-terminal part of the NC1 domain of the α1 chain of type IV collagen is important in the integrity of glomerular basement membrane in humans. Oxford University Press 2016-11 2016-04-08 /pmc/articles/PMC5091614/ /pubmed/27190376 http://dx.doi.org/10.1093/ndt/gfw051 Text en © The Author 2016. Published by Oxford University Press on behalf of ERA-EDTA. http://creativecommons.org/licenses/by/4.0/ This is an Open Access article distributed under the terms of the Creative Commons Attribution License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted reuse, distribution, and reproduction in any medium, provided the original work is properly cited.
spellingShingle CLINICAL SCIENCE
Gale, Daniel P.
Oygar, D. Deren
Lin, Fujun
Oygar, P. Derin
Khan, Nadia
Connor, Thomas M.F.
Lapsley, Marta
Maxwell, Patrick H.
Neild, Guy H.
A novel COL4A1 frameshift mutation in familial kidney disease: the importance of the C-terminal NC1 domain of type IV collagen
title A novel COL4A1 frameshift mutation in familial kidney disease: the importance of the C-terminal NC1 domain of type IV collagen
title_full A novel COL4A1 frameshift mutation in familial kidney disease: the importance of the C-terminal NC1 domain of type IV collagen
title_fullStr A novel COL4A1 frameshift mutation in familial kidney disease: the importance of the C-terminal NC1 domain of type IV collagen
title_full_unstemmed A novel COL4A1 frameshift mutation in familial kidney disease: the importance of the C-terminal NC1 domain of type IV collagen
title_short A novel COL4A1 frameshift mutation in familial kidney disease: the importance of the C-terminal NC1 domain of type IV collagen
title_sort novel col4a1 frameshift mutation in familial kidney disease: the importance of the c-terminal nc1 domain of type iv collagen
topic CLINICAL SCIENCE
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5091614/
https://www.ncbi.nlm.nih.gov/pubmed/27190376
http://dx.doi.org/10.1093/ndt/gfw051
work_keys_str_mv AT galedanielp anovelcol4a1frameshiftmutationinfamilialkidneydiseasetheimportanceofthecterminalnc1domainoftypeivcollagen
AT oygardderen anovelcol4a1frameshiftmutationinfamilialkidneydiseasetheimportanceofthecterminalnc1domainoftypeivcollagen
AT linfujun anovelcol4a1frameshiftmutationinfamilialkidneydiseasetheimportanceofthecterminalnc1domainoftypeivcollagen
AT oygarpderin anovelcol4a1frameshiftmutationinfamilialkidneydiseasetheimportanceofthecterminalnc1domainoftypeivcollagen
AT khannadia anovelcol4a1frameshiftmutationinfamilialkidneydiseasetheimportanceofthecterminalnc1domainoftypeivcollagen
AT connorthomasmf anovelcol4a1frameshiftmutationinfamilialkidneydiseasetheimportanceofthecterminalnc1domainoftypeivcollagen
AT lapsleymarta anovelcol4a1frameshiftmutationinfamilialkidneydiseasetheimportanceofthecterminalnc1domainoftypeivcollagen
AT maxwellpatrickh anovelcol4a1frameshiftmutationinfamilialkidneydiseasetheimportanceofthecterminalnc1domainoftypeivcollagen
AT neildguyh anovelcol4a1frameshiftmutationinfamilialkidneydiseasetheimportanceofthecterminalnc1domainoftypeivcollagen
AT galedanielp novelcol4a1frameshiftmutationinfamilialkidneydiseasetheimportanceofthecterminalnc1domainoftypeivcollagen
AT oygardderen novelcol4a1frameshiftmutationinfamilialkidneydiseasetheimportanceofthecterminalnc1domainoftypeivcollagen
AT linfujun novelcol4a1frameshiftmutationinfamilialkidneydiseasetheimportanceofthecterminalnc1domainoftypeivcollagen
AT oygarpderin novelcol4a1frameshiftmutationinfamilialkidneydiseasetheimportanceofthecterminalnc1domainoftypeivcollagen
AT khannadia novelcol4a1frameshiftmutationinfamilialkidneydiseasetheimportanceofthecterminalnc1domainoftypeivcollagen
AT connorthomasmf novelcol4a1frameshiftmutationinfamilialkidneydiseasetheimportanceofthecterminalnc1domainoftypeivcollagen
AT lapsleymarta novelcol4a1frameshiftmutationinfamilialkidneydiseasetheimportanceofthecterminalnc1domainoftypeivcollagen
AT maxwellpatrickh novelcol4a1frameshiftmutationinfamilialkidneydiseasetheimportanceofthecterminalnc1domainoftypeivcollagen
AT neildguyh novelcol4a1frameshiftmutationinfamilialkidneydiseasetheimportanceofthecterminalnc1domainoftypeivcollagen