Cargando…

Long-Term Treatment by Vitamin B(1) and Reduction of Serum Proinflammatory Cytokines, Hyperalgesia, and Paw Edema in Adjuvant-Induced Arthritis

INTRODUCTION: Immune system is involved in the etiology and pathophysiology of inflammation and vitamins are important sources of substances inducing nonspecific immunomodulatory effects. Given the proinflammatory role of cytokines in the inflammation and pain induction, this study aimed to assess t...

Descripción completa

Detalles Bibliográficos
Autores principales: Zaringhalam, Jalal, Akbari, Akhtar, Zali, Alireza, Manaheji, Homa, Nazemian, Vida, Shadnoush, Mahdi, Ezzatpanah, Somayeh
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Iranian Neuroscience Society 2016
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5102562/
https://www.ncbi.nlm.nih.gov/pubmed/27872694
http://dx.doi.org/10.15412/J.BCN.03070406
_version_ 1782466444054757376
author Zaringhalam, Jalal
Akbari, Akhtar
Zali, Alireza
Manaheji, Homa
Nazemian, Vida
Shadnoush, Mahdi
Ezzatpanah, Somayeh
author_facet Zaringhalam, Jalal
Akbari, Akhtar
Zali, Alireza
Manaheji, Homa
Nazemian, Vida
Shadnoush, Mahdi
Ezzatpanah, Somayeh
author_sort Zaringhalam, Jalal
collection PubMed
description INTRODUCTION: Immune system is involved in the etiology and pathophysiology of inflammation and vitamins are important sources of substances inducing nonspecific immunomodulatory effects. Given the proinflammatory role of cytokines in the inflammation and pain induction, this study aimed to assess the effects of long-term administration of vitamin B(1) on the proinflammatory cytokines, edema, and hyperalgesia during the acute and chronic phases of adjuvant-induced arthritis. METHODS: On the first day of study, inflammation was induced by intraplantar injection of complete Freund's adjuvant (CFA) in the hindpaws of rats. Vitamin B(1) at doses of 100, 150, and 200 mg/kg was administrated intraperitoneally during 21 days of the study. Antinociceptive and anti-inflammatory effects of vitamin B(1) were also compared to indomethacin (5 mg/kg). Inflammatory symptoms such as thermal hyperalgesia and paw edema were measured by radiant heat and plethysmometer, respectively. Serum TNF-α and IL-1β levels were checked by rat standard enzyme-linked immune sorbent assay (ELISA) specific kits. RESULTS: The results indicated that vitamin B(1)(150 and 200 mg/kg) attenuated the paw edema, thermal hyperalgesia, and serum levels of TNF-α and IL-1β during both phases of CFA-induced inflammation in a dose-dependent manner. Effective dose of vitamin B(1)(150 mg/kg) reduced inflammatory symptoms and serum levels of TNF-α and IL-1β compare to indomethacin during the chronic phase of inflammation. CONCLUSION: Anti-inflammatory and antihyperalgesic effects of vitamin B1 during CFA-induced arthritis, more specifically after chronic vitamin B(1) administration, suggest its therapeutic property for inflammation.
format Online
Article
Text
id pubmed-5102562
institution National Center for Biotechnology Information
language English
publishDate 2016
publisher Iranian Neuroscience Society
record_format MEDLINE/PubMed
spelling pubmed-51025622016-11-21 Long-Term Treatment by Vitamin B(1) and Reduction of Serum Proinflammatory Cytokines, Hyperalgesia, and Paw Edema in Adjuvant-Induced Arthritis Zaringhalam, Jalal Akbari, Akhtar Zali, Alireza Manaheji, Homa Nazemian, Vida Shadnoush, Mahdi Ezzatpanah, Somayeh Basic Clin Neurosci Research Paper INTRODUCTION: Immune system is involved in the etiology and pathophysiology of inflammation and vitamins are important sources of substances inducing nonspecific immunomodulatory effects. Given the proinflammatory role of cytokines in the inflammation and pain induction, this study aimed to assess the effects of long-term administration of vitamin B(1) on the proinflammatory cytokines, edema, and hyperalgesia during the acute and chronic phases of adjuvant-induced arthritis. METHODS: On the first day of study, inflammation was induced by intraplantar injection of complete Freund's adjuvant (CFA) in the hindpaws of rats. Vitamin B(1) at doses of 100, 150, and 200 mg/kg was administrated intraperitoneally during 21 days of the study. Antinociceptive and anti-inflammatory effects of vitamin B(1) were also compared to indomethacin (5 mg/kg). Inflammatory symptoms such as thermal hyperalgesia and paw edema were measured by radiant heat and plethysmometer, respectively. Serum TNF-α and IL-1β levels were checked by rat standard enzyme-linked immune sorbent assay (ELISA) specific kits. RESULTS: The results indicated that vitamin B(1)(150 and 200 mg/kg) attenuated the paw edema, thermal hyperalgesia, and serum levels of TNF-α and IL-1β during both phases of CFA-induced inflammation in a dose-dependent manner. Effective dose of vitamin B(1)(150 mg/kg) reduced inflammatory symptoms and serum levels of TNF-α and IL-1β compare to indomethacin during the chronic phase of inflammation. CONCLUSION: Anti-inflammatory and antihyperalgesic effects of vitamin B1 during CFA-induced arthritis, more specifically after chronic vitamin B(1) administration, suggest its therapeutic property for inflammation. Iranian Neuroscience Society 2016-10 /pmc/articles/PMC5102562/ /pubmed/27872694 http://dx.doi.org/10.15412/J.BCN.03070406 Text en Copyright© 2016 Iranian Neuroscience Society This work is licensed under a Creative Commons Attribution-NonCommercial 3.0 Unported License which allows users to read, copy, distribute and make derivative works for non-commercial purposes from the material, as long as the author of the original work is cited properly.
spellingShingle Research Paper
Zaringhalam, Jalal
Akbari, Akhtar
Zali, Alireza
Manaheji, Homa
Nazemian, Vida
Shadnoush, Mahdi
Ezzatpanah, Somayeh
Long-Term Treatment by Vitamin B(1) and Reduction of Serum Proinflammatory Cytokines, Hyperalgesia, and Paw Edema in Adjuvant-Induced Arthritis
title Long-Term Treatment by Vitamin B(1) and Reduction of Serum Proinflammatory Cytokines, Hyperalgesia, and Paw Edema in Adjuvant-Induced Arthritis
title_full Long-Term Treatment by Vitamin B(1) and Reduction of Serum Proinflammatory Cytokines, Hyperalgesia, and Paw Edema in Adjuvant-Induced Arthritis
title_fullStr Long-Term Treatment by Vitamin B(1) and Reduction of Serum Proinflammatory Cytokines, Hyperalgesia, and Paw Edema in Adjuvant-Induced Arthritis
title_full_unstemmed Long-Term Treatment by Vitamin B(1) and Reduction of Serum Proinflammatory Cytokines, Hyperalgesia, and Paw Edema in Adjuvant-Induced Arthritis
title_short Long-Term Treatment by Vitamin B(1) and Reduction of Serum Proinflammatory Cytokines, Hyperalgesia, and Paw Edema in Adjuvant-Induced Arthritis
title_sort long-term treatment by vitamin b(1) and reduction of serum proinflammatory cytokines, hyperalgesia, and paw edema in adjuvant-induced arthritis
topic Research Paper
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5102562/
https://www.ncbi.nlm.nih.gov/pubmed/27872694
http://dx.doi.org/10.15412/J.BCN.03070406
work_keys_str_mv AT zaringhalamjalal longtermtreatmentbyvitaminb1andreductionofserumproinflammatorycytokineshyperalgesiaandpawedemainadjuvantinducedarthritis
AT akbariakhtar longtermtreatmentbyvitaminb1andreductionofserumproinflammatorycytokineshyperalgesiaandpawedemainadjuvantinducedarthritis
AT zalialireza longtermtreatmentbyvitaminb1andreductionofserumproinflammatorycytokineshyperalgesiaandpawedemainadjuvantinducedarthritis
AT manahejihoma longtermtreatmentbyvitaminb1andreductionofserumproinflammatorycytokineshyperalgesiaandpawedemainadjuvantinducedarthritis
AT nazemianvida longtermtreatmentbyvitaminb1andreductionofserumproinflammatorycytokineshyperalgesiaandpawedemainadjuvantinducedarthritis
AT shadnoushmahdi longtermtreatmentbyvitaminb1andreductionofserumproinflammatorycytokineshyperalgesiaandpawedemainadjuvantinducedarthritis
AT ezzatpanahsomayeh longtermtreatmentbyvitaminb1andreductionofserumproinflammatorycytokineshyperalgesiaandpawedemainadjuvantinducedarthritis