The role of HGF/c-MET signaling pathway in lymphoma

Inappropriate activation of c-mesenchymal-epithelial transition (MET), the receptor tyrosine kinase (RTK) for hepatocyte growth factor (HGF), has been implicated in tumorigenesis and represented a promising therapeutic target for developing anticancer agents. In contrast to other solid tumors, there...

Descripción completa

Detalles Bibliográficos
Autores principales: Lam, Bao Quoc, Dai, Lu, Qin, Zhiqiang
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2016
Materias:
Review
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5141645/
https://www.ncbi.nlm.nih.gov/pubmed/27923392
http://dx.doi.org/10.1186/s13045-016-0366-y
_version_ 1782472652795936768
author Lam, Bao Quoc
Dai, Lu
Qin, Zhiqiang
author_facet Lam, Bao Quoc
Dai, Lu
Qin, Zhiqiang
author_sort Lam, Bao Quoc
collection PubMed
description Inappropriate activation of c-mesenchymal-epithelial transition (MET), the receptor tyrosine kinase (RTK) for hepatocyte growth factor (HGF), has been implicated in tumorigenesis and represented a promising therapeutic target for developing anticancer agents. In contrast to other solid tumors, there are limited data describing the functional role of HGF/c-MET signaling pathway in lymphoma. In the current review, we summarize recent findings about the expression, cellular mechanisms/functions, and therapeutic application of HGF/c-MET in different types of lymphoma, especially B cell lymphoma, T and NK cell lymphoma, and Hodgkin lymphoma. We also discuss the existing problems and future directions about studying the HGF/c-MET pathway in lymphoma cells.
format Online
Article
Text
id pubmed-5141645
institution National Center for Biotechnology Information
language English
publishDate 2016
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-51416452016-12-15 The role of HGF/c-MET signaling pathway in lymphoma Lam, Bao Quoc Dai, Lu Qin, Zhiqiang J Hematol Oncol Review Inappropriate activation of c-mesenchymal-epithelial transition (MET), the receptor tyrosine kinase (RTK) for hepatocyte growth factor (HGF), has been implicated in tumorigenesis and represented a promising therapeutic target for developing anticancer agents. In contrast to other solid tumors, there are limited data describing the functional role of HGF/c-MET signaling pathway in lymphoma. In the current review, we summarize recent findings about the expression, cellular mechanisms/functions, and therapeutic application of HGF/c-MET in different types of lymphoma, especially B cell lymphoma, T and NK cell lymphoma, and Hodgkin lymphoma. We also discuss the existing problems and future directions about studying the HGF/c-MET pathway in lymphoma cells. BioMed Central 2016-12-07 /pmc/articles/PMC5141645/ /pubmed/27923392 http://dx.doi.org/10.1186/s13045-016-0366-y Text en © The Author(s). 2016 Open AccessThis article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated.
spellingShingle Review
Lam, Bao Quoc
Dai, Lu
Qin, Zhiqiang
The role of HGF/c-MET signaling pathway in lymphoma
title The role of HGF/c-MET signaling pathway in lymphoma
title_full The role of HGF/c-MET signaling pathway in lymphoma
title_fullStr The role of HGF/c-MET signaling pathway in lymphoma
title_full_unstemmed The role of HGF/c-MET signaling pathway in lymphoma
title_short The role of HGF/c-MET signaling pathway in lymphoma
title_sort role of hgf/c-met signaling pathway in lymphoma
topic Review
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5141645/
https://www.ncbi.nlm.nih.gov/pubmed/27923392
http://dx.doi.org/10.1186/s13045-016-0366-y
work_keys_str_mv AT lambaoquoc theroleofhgfcmetsignalingpathwayinlymphoma
AT dailu theroleofhgfcmetsignalingpathwayinlymphoma
AT qinzhiqiang theroleofhgfcmetsignalingpathwayinlymphoma
AT lambaoquoc roleofhgfcmetsignalingpathwayinlymphoma
AT dailu roleofhgfcmetsignalingpathwayinlymphoma
AT qinzhiqiang roleofhgfcmetsignalingpathwayinlymphoma

Ejemplares similares