Cargando…
Erratum to: A randomized prospective controlled trial comparing the laryngeal tube suction disposable and the supreme laryngeal mask airway: the influence of head and neck position on oropharyngeal seal pressure
| Autores principales: | , , , , , , , , |
|---|---|
| Formato: | Online Artículo Texto |
| Lenguaje: | English |
| Publicado: |
BioMed Central
2016
|
| Materias: | |
| Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5154063/ https://www.ncbi.nlm.nih.gov/pubmed/27964732 http://dx.doi.org/10.1186/s12871-016-0290-2 |
| _version_ | 1782474810009321472 |
|---|---|
| author | Somri, Mostafa Vaida, Sonia Garcia Fornari, Gustavo Mendoza, Gabriela Renee Charco-Mora, Pedro Hawash, Naser Matter, Ibrahim Swaid, Forat Gaitini, Luis |
| author_facet | Somri, Mostafa Vaida, Sonia Garcia Fornari, Gustavo Mendoza, Gabriela Renee Charco-Mora, Pedro Hawash, Naser Matter, Ibrahim Swaid, Forat Gaitini, Luis |
| author_sort | Somri, Mostafa |
| collection | PubMed |
| description | |
| format | Online Article Text |
| id | pubmed-5154063 |
| institution | National Center for Biotechnology Information |
| language | English |
| publishDate | 2016 |
| publisher | BioMed Central |
| record_format | MEDLINE/PubMed |
| spelling | pubmed-51540632016-12-20 Erratum to: A randomized prospective controlled trial comparing the laryngeal tube suction disposable and the supreme laryngeal mask airway: the influence of head and neck position on oropharyngeal seal pressure Somri, Mostafa Vaida, Sonia Garcia Fornari, Gustavo Mendoza, Gabriela Renee Charco-Mora, Pedro Hawash, Naser Matter, Ibrahim Swaid, Forat Gaitini, Luis BMC Anesthesiol Erratum BioMed Central 2016-12-13 /pmc/articles/PMC5154063/ /pubmed/27964732 http://dx.doi.org/10.1186/s12871-016-0290-2 Text en © The Author(s). 2016 Open AccessThis article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated. |
| spellingShingle | Erratum Somri, Mostafa Vaida, Sonia Garcia Fornari, Gustavo Mendoza, Gabriela Renee Charco-Mora, Pedro Hawash, Naser Matter, Ibrahim Swaid, Forat Gaitini, Luis Erratum to: A randomized prospective controlled trial comparing the laryngeal tube suction disposable and the supreme laryngeal mask airway: the influence of head and neck position on oropharyngeal seal pressure |
| title | Erratum to: A randomized prospective controlled trial comparing the laryngeal tube suction disposable and the supreme laryngeal mask airway: the influence of head and neck position on oropharyngeal seal pressure |
| title_full | Erratum to: A randomized prospective controlled trial comparing the laryngeal tube suction disposable and the supreme laryngeal mask airway: the influence of head and neck position on oropharyngeal seal pressure |
| title_fullStr | Erratum to: A randomized prospective controlled trial comparing the laryngeal tube suction disposable and the supreme laryngeal mask airway: the influence of head and neck position on oropharyngeal seal pressure |
| title_full_unstemmed | Erratum to: A randomized prospective controlled trial comparing the laryngeal tube suction disposable and the supreme laryngeal mask airway: the influence of head and neck position on oropharyngeal seal pressure |
| title_short | Erratum to: A randomized prospective controlled trial comparing the laryngeal tube suction disposable and the supreme laryngeal mask airway: the influence of head and neck position on oropharyngeal seal pressure |
| title_sort | erratum to: a randomized prospective controlled trial comparing the laryngeal tube suction disposable and the supreme laryngeal mask airway: the influence of head and neck position on oropharyngeal seal pressure |
| topic | Erratum |
| url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5154063/ https://www.ncbi.nlm.nih.gov/pubmed/27964732 http://dx.doi.org/10.1186/s12871-016-0290-2 |
| work_keys_str_mv | AT somrimostafa erratumtoarandomizedprospectivecontrolledtrialcomparingthelaryngealtubesuctiondisposableandthesupremelaryngealmaskairwaytheinfluenceofheadandneckpositiononoropharyngealsealpressure AT vaidasonia erratumtoarandomizedprospectivecontrolledtrialcomparingthelaryngealtubesuctiondisposableandthesupremelaryngealmaskairwaytheinfluenceofheadandneckpositiononoropharyngealsealpressure AT garciafornarigustavo erratumtoarandomizedprospectivecontrolledtrialcomparingthelaryngealtubesuctiondisposableandthesupremelaryngealmaskairwaytheinfluenceofheadandneckpositiononoropharyngealsealpressure AT mendozagabrielarenee erratumtoarandomizedprospectivecontrolledtrialcomparingthelaryngealtubesuctiondisposableandthesupremelaryngealmaskairwaytheinfluenceofheadandneckpositiononoropharyngealsealpressure AT charcomorapedro erratumtoarandomizedprospectivecontrolledtrialcomparingthelaryngealtubesuctiondisposableandthesupremelaryngealmaskairwaytheinfluenceofheadandneckpositiononoropharyngealsealpressure AT hawashnaser erratumtoarandomizedprospectivecontrolledtrialcomparingthelaryngealtubesuctiondisposableandthesupremelaryngealmaskairwaytheinfluenceofheadandneckpositiononoropharyngealsealpressure AT matteribrahim erratumtoarandomizedprospectivecontrolledtrialcomparingthelaryngealtubesuctiondisposableandthesupremelaryngealmaskairwaytheinfluenceofheadandneckpositiononoropharyngealsealpressure AT swaidforat erratumtoarandomizedprospectivecontrolledtrialcomparingthelaryngealtubesuctiondisposableandthesupremelaryngealmaskairwaytheinfluenceofheadandneckpositiononoropharyngealsealpressure AT gaitiniluis erratumtoarandomizedprospectivecontrolledtrialcomparingthelaryngealtubesuctiondisposableandthesupremelaryngealmaskairwaytheinfluenceofheadandneckpositiononoropharyngealsealpressure |