Cargando…

Diagnosis of LCHAD/TFP deficiency in an at risk newborn using umbilical cord blood acylcarnitine analysis

Trifunctional protein deficiency/Long-chain hydroxyacyl-CoA dehydrogenase deficiency (LCHAD/TFP) deficiency is a disorder of fatty acid oxidation and ketogenesis. Severe neonatal lactic acidosis, cardiomyopathy, and hepatic dysfunction are caused by the accumulation of toxic long-chain acylcarnitine...

Descripción completa

Detalles Bibliográficos
Autores principales: Raval, Donna B., Cusmano-Ozog, Kristina P., Ayyub, Omar, Jenevein, Callie, Kofman, Laura H., Lanpher, Brendan, Hauser, Natalie, Regier, Debra S.
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Elsevier 2016
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5155040/
https://www.ncbi.nlm.nih.gov/pubmed/27995076
http://dx.doi.org/10.1016/j.ymgmr.2016.11.007
_version_ 1782474930834636800
author Raval, Donna B.
Cusmano-Ozog, Kristina P.
Ayyub, Omar
Jenevein, Callie
Kofman, Laura H.
Lanpher, Brendan
Hauser, Natalie
Regier, Debra S.
author_facet Raval, Donna B.
Cusmano-Ozog, Kristina P.
Ayyub, Omar
Jenevein, Callie
Kofman, Laura H.
Lanpher, Brendan
Hauser, Natalie
Regier, Debra S.
author_sort Raval, Donna B.
collection PubMed
description Trifunctional protein deficiency/Long-chain hydroxyacyl-CoA dehydrogenase deficiency (LCHAD/TFP) deficiency is a disorder of fatty acid oxidation and ketogenesis. Severe neonatal lactic acidosis, cardiomyopathy, and hepatic dysfunction are caused by the accumulation of toxic long-chain acylcarnitines. The feasibility of umbilical cord blood use in screening for acylcarnitine analysis and free carnitine has been hypothesized but not reported in LCHAD/TFP neonates. We present a 4 week old female who was at risk of inheriting LCHAD/TFP deficiency and was diagnosed at the time of delivery using umbilical cord blood. Umbilical cord blood was collected at delivery and sent for acylcarnitine analysis. Treatment was started immediately. Acylcarnitine analysis demonstrated findings that are consistent with a biochemical diagnosis of LCHAD/TFP deficiency. Patients with LCHAD/TFP deficiency should have treatment initiated as early as possible to avoid acute decompensation and minimize the long-term complications of the disorder including cardiomyopathy. In pregnancies at risk of having a child with LCHAD/TFP deficiency, umbilical cord blood sample is an efficient method to diagnose an inborn error of metabolism such as LCHAD/TFP deficiency.
format Online
Article
Text
id pubmed-5155040
institution National Center for Biotechnology Information
language English
publishDate 2016
publisher Elsevier
record_format MEDLINE/PubMed
spelling pubmed-51550402016-12-19 Diagnosis of LCHAD/TFP deficiency in an at risk newborn using umbilical cord blood acylcarnitine analysis Raval, Donna B. Cusmano-Ozog, Kristina P. Ayyub, Omar Jenevein, Callie Kofman, Laura H. Lanpher, Brendan Hauser, Natalie Regier, Debra S. Mol Genet Metab Rep Case Report Trifunctional protein deficiency/Long-chain hydroxyacyl-CoA dehydrogenase deficiency (LCHAD/TFP) deficiency is a disorder of fatty acid oxidation and ketogenesis. Severe neonatal lactic acidosis, cardiomyopathy, and hepatic dysfunction are caused by the accumulation of toxic long-chain acylcarnitines. The feasibility of umbilical cord blood use in screening for acylcarnitine analysis and free carnitine has been hypothesized but not reported in LCHAD/TFP neonates. We present a 4 week old female who was at risk of inheriting LCHAD/TFP deficiency and was diagnosed at the time of delivery using umbilical cord blood. Umbilical cord blood was collected at delivery and sent for acylcarnitine analysis. Treatment was started immediately. Acylcarnitine analysis demonstrated findings that are consistent with a biochemical diagnosis of LCHAD/TFP deficiency. Patients with LCHAD/TFP deficiency should have treatment initiated as early as possible to avoid acute decompensation and minimize the long-term complications of the disorder including cardiomyopathy. In pregnancies at risk of having a child with LCHAD/TFP deficiency, umbilical cord blood sample is an efficient method to diagnose an inborn error of metabolism such as LCHAD/TFP deficiency. Elsevier 2016-12-09 /pmc/articles/PMC5155040/ /pubmed/27995076 http://dx.doi.org/10.1016/j.ymgmr.2016.11.007 Text en © 2016 The Authors http://creativecommons.org/licenses/by-nc-nd/4.0/ This is an open access article under the CC BY-NC-ND license (http://creativecommons.org/licenses/by-nc-nd/4.0/).
spellingShingle Case Report
Raval, Donna B.
Cusmano-Ozog, Kristina P.
Ayyub, Omar
Jenevein, Callie
Kofman, Laura H.
Lanpher, Brendan
Hauser, Natalie
Regier, Debra S.
Diagnosis of LCHAD/TFP deficiency in an at risk newborn using umbilical cord blood acylcarnitine analysis
title Diagnosis of LCHAD/TFP deficiency in an at risk newborn using umbilical cord blood acylcarnitine analysis
title_full Diagnosis of LCHAD/TFP deficiency in an at risk newborn using umbilical cord blood acylcarnitine analysis
title_fullStr Diagnosis of LCHAD/TFP deficiency in an at risk newborn using umbilical cord blood acylcarnitine analysis
title_full_unstemmed Diagnosis of LCHAD/TFP deficiency in an at risk newborn using umbilical cord blood acylcarnitine analysis
title_short Diagnosis of LCHAD/TFP deficiency in an at risk newborn using umbilical cord blood acylcarnitine analysis
title_sort diagnosis of lchad/tfp deficiency in an at risk newborn using umbilical cord blood acylcarnitine analysis
topic Case Report
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5155040/
https://www.ncbi.nlm.nih.gov/pubmed/27995076
http://dx.doi.org/10.1016/j.ymgmr.2016.11.007
work_keys_str_mv AT ravaldonnab diagnosisoflchadtfpdeficiencyinanatrisknewbornusingumbilicalcordbloodacylcarnitineanalysis
AT cusmanoozogkristinap diagnosisoflchadtfpdeficiencyinanatrisknewbornusingumbilicalcordbloodacylcarnitineanalysis
AT ayyubomar diagnosisoflchadtfpdeficiencyinanatrisknewbornusingumbilicalcordbloodacylcarnitineanalysis
AT jeneveincallie diagnosisoflchadtfpdeficiencyinanatrisknewbornusingumbilicalcordbloodacylcarnitineanalysis
AT kofmanlaurah diagnosisoflchadtfpdeficiencyinanatrisknewbornusingumbilicalcordbloodacylcarnitineanalysis
AT lanpherbrendan diagnosisoflchadtfpdeficiencyinanatrisknewbornusingumbilicalcordbloodacylcarnitineanalysis
AT hausernatalie diagnosisoflchadtfpdeficiencyinanatrisknewbornusingumbilicalcordbloodacylcarnitineanalysis
AT regierdebras diagnosisoflchadtfpdeficiencyinanatrisknewbornusingumbilicalcordbloodacylcarnitineanalysis