Cargando…

Vitamin D deficiency and its impact on asthma severity in asthmatic children

BACKGROUND: Despite obtaining evidences on association between vitamin D and development of lung in fetus, little is known about vitamin D level and its impact on severity of asthma in children. The present study aimed to assess the relationship between the asthma severity and vitamin D deficiency i...

Descripción completa

Detalles Bibliográficos
Autores principales: Esfandiar, Nasrin, Alaei, Fariba, Fallah, Shahrzad, Babaie, Delara, Sedghi, Niloofar
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2016
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5164917/
https://www.ncbi.nlm.nih.gov/pubmed/27987538
http://dx.doi.org/10.1186/s13052-016-0300-5
_version_ 1782482758165069824
author Esfandiar, Nasrin
Alaei, Fariba
Fallah, Shahrzad
Babaie, Delara
Sedghi, Niloofar
author_facet Esfandiar, Nasrin
Alaei, Fariba
Fallah, Shahrzad
Babaie, Delara
Sedghi, Niloofar
author_sort Esfandiar, Nasrin
collection PubMed
description BACKGROUND: Despite obtaining evidences on association between vitamin D and development of lung in fetus, little is known about vitamin D level and its impact on severity of asthma in children. The present study aimed to assess the relationship between the asthma severity and vitamin D deficiency in asthmatic children. METHODS: This case-control study was conducted on 106 individuals including asthmatic (n = 53) and healthy children (n = 53) who referred to Mofid hospital in Tehran in 2013. The level of serum vitamin D in both groups was measured by radioimmunoassay method at the reference lab and was categorized as sufficient (> 30 ng/ml), insufficient (20 to 30 ng/ml), or deficient (< 20 ng/ml). The control status of asthma in patients group was classified as controlled, partially controlled, and uncontrolled. RESULTS: In the groups with and without asthma, the prevalence of vitamin D deficiency was 73.6 and 49.1%, and the prevalence of vitamin D insufficiency was 18.9 and 18.9%, while normal vitamin D level was revealed in 7.5 and 32.1%, respectively with a significant difference (p = 0.005). Using the multivariate logistic regression analysis, the presence of asthma was associated with reduced level of vitamin D (OR = 1.068, 95% CI: 1.027–1.110, P = 0.001). In this context, the risk for asthma in the children with vitamin D deficiency was 6.3 times of those with normal vitamin D level. Although the presence of asthma was strongly associated with reduced level of vitamin D in serum, neither severity of asthma nor control status of asthma were associated with vitamin D deficiency. CONCLUSION: The presence of vitamin D deficiency effectively predict increased risk for childhood asthma; however the severity or control status of this event may not be predicted by confirming vitamin D deficiency.
format Online
Article
Text
id pubmed-5164917
institution National Center for Biotechnology Information
language English
publishDate 2016
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-51649172016-12-23 Vitamin D deficiency and its impact on asthma severity in asthmatic children Esfandiar, Nasrin Alaei, Fariba Fallah, Shahrzad Babaie, Delara Sedghi, Niloofar Ital J Pediatr Research BACKGROUND: Despite obtaining evidences on association between vitamin D and development of lung in fetus, little is known about vitamin D level and its impact on severity of asthma in children. The present study aimed to assess the relationship between the asthma severity and vitamin D deficiency in asthmatic children. METHODS: This case-control study was conducted on 106 individuals including asthmatic (n = 53) and healthy children (n = 53) who referred to Mofid hospital in Tehran in 2013. The level of serum vitamin D in both groups was measured by radioimmunoassay method at the reference lab and was categorized as sufficient (> 30 ng/ml), insufficient (20 to 30 ng/ml), or deficient (< 20 ng/ml). The control status of asthma in patients group was classified as controlled, partially controlled, and uncontrolled. RESULTS: In the groups with and without asthma, the prevalence of vitamin D deficiency was 73.6 and 49.1%, and the prevalence of vitamin D insufficiency was 18.9 and 18.9%, while normal vitamin D level was revealed in 7.5 and 32.1%, respectively with a significant difference (p = 0.005). Using the multivariate logistic regression analysis, the presence of asthma was associated with reduced level of vitamin D (OR = 1.068, 95% CI: 1.027–1.110, P = 0.001). In this context, the risk for asthma in the children with vitamin D deficiency was 6.3 times of those with normal vitamin D level. Although the presence of asthma was strongly associated with reduced level of vitamin D in serum, neither severity of asthma nor control status of asthma were associated with vitamin D deficiency. CONCLUSION: The presence of vitamin D deficiency effectively predict increased risk for childhood asthma; however the severity or control status of this event may not be predicted by confirming vitamin D deficiency. BioMed Central 2016-12-17 /pmc/articles/PMC5164917/ /pubmed/27987538 http://dx.doi.org/10.1186/s13052-016-0300-5 Text en © The Author(s). 2016 Open AccessThis article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated.
spellingShingle Research
Esfandiar, Nasrin
Alaei, Fariba
Fallah, Shahrzad
Babaie, Delara
Sedghi, Niloofar
Vitamin D deficiency and its impact on asthma severity in asthmatic children
title Vitamin D deficiency and its impact on asthma severity in asthmatic children
title_full Vitamin D deficiency and its impact on asthma severity in asthmatic children
title_fullStr Vitamin D deficiency and its impact on asthma severity in asthmatic children
title_full_unstemmed Vitamin D deficiency and its impact on asthma severity in asthmatic children
title_short Vitamin D deficiency and its impact on asthma severity in asthmatic children
title_sort vitamin d deficiency and its impact on asthma severity in asthmatic children
topic Research
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5164917/
https://www.ncbi.nlm.nih.gov/pubmed/27987538
http://dx.doi.org/10.1186/s13052-016-0300-5
work_keys_str_mv AT esfandiarnasrin vitaminddeficiencyanditsimpactonasthmaseverityinasthmaticchildren
AT alaeifariba vitaminddeficiencyanditsimpactonasthmaseverityinasthmaticchildren
AT fallahshahrzad vitaminddeficiencyanditsimpactonasthmaseverityinasthmaticchildren
AT babaiedelara vitaminddeficiencyanditsimpactonasthmaseverityinasthmaticchildren
AT sedghiniloofar vitaminddeficiencyanditsimpactonasthmaseverityinasthmaticchildren