Cargando…
Multiple infections of Anaplasma platys variants in Philippine dogs
AIM: Anaplasma platys, the causative agent of infectious canine cyclic thrombocytopenia, is a tick-borne pathogen that also has been implicated as potentially zoonotic. To provide molecular evidence on the multiple infections of A. platys variants in Philippine dogs. MATERIALS AND METHODS: DNA fragm...
Autores principales: | , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Veterinary World
2016
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5234063/ https://www.ncbi.nlm.nih.gov/pubmed/28096621 http://dx.doi.org/10.14202/vetworld.2016.1456-1460 |
_version_ | 1782494932435468288 |
---|---|
author | Ybañez, Adrian Patalinghug Ybañez, Rochelle Haidee Daclan Yokoyama, Naoaki Inokuma, Hisashi |
author_facet | Ybañez, Adrian Patalinghug Ybañez, Rochelle Haidee Daclan Yokoyama, Naoaki Inokuma, Hisashi |
author_sort | Ybañez, Adrian Patalinghug |
collection | PubMed |
description | AIM: Anaplasma platys, the causative agent of infectious canine cyclic thrombocytopenia, is a tick-borne pathogen that also has been implicated as potentially zoonotic. To provide molecular evidence on the multiple infections of A. platys variants in Philippine dogs. MATERIALS AND METHODS: DNA fragments of A. platys from infected dogs in the Philippines were molecularly characterized. For screening, 25 dogs suspected to have canine anaplasmosis were tested using a 16S rRNA-based nested polymerase chain reaction (PCR). Infection was confirmed by sequencing of positive amplicons. Second round PCR targeting a longer 16S rRNA fragment was subsequently performed on the first round PCR amplicons of the positive samples. Further characterization using the heat-shock operon (groEL) gene was also performed on the A. platys-positive samples. RESULTS: 10 16S rRNA sequences were obtained and found 99.6-100% identical to each other and 99.6-99.7% identical to the closest registered A. platys sequences. On the other hand, 36 groEL clone sequences were obtained and found to be 85.1-99.8% identical with each other and 85.0-88.9% identical to the closest previously registered A. platys sequences. Four dogs were found coinfected with 2-3 groEL variant sequences. Phylogenetic analyses suggest that the detected A. platys in the Philippines may represent unique variants. CONCLUSION: A. platys variants were detected in Philippine dogs. Coinfection of different A. platys variants in dogs was also demonstrated. The present study may indicate the potential genetic diversity of A. platys in the country. |
format | Online Article Text |
id | pubmed-5234063 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2016 |
publisher | Veterinary World |
record_format | MEDLINE/PubMed |
spelling | pubmed-52340632017-01-17 Multiple infections of Anaplasma platys variants in Philippine dogs Ybañez, Adrian Patalinghug Ybañez, Rochelle Haidee Daclan Yokoyama, Naoaki Inokuma, Hisashi Vet World Research Article AIM: Anaplasma platys, the causative agent of infectious canine cyclic thrombocytopenia, is a tick-borne pathogen that also has been implicated as potentially zoonotic. To provide molecular evidence on the multiple infections of A. platys variants in Philippine dogs. MATERIALS AND METHODS: DNA fragments of A. platys from infected dogs in the Philippines were molecularly characterized. For screening, 25 dogs suspected to have canine anaplasmosis were tested using a 16S rRNA-based nested polymerase chain reaction (PCR). Infection was confirmed by sequencing of positive amplicons. Second round PCR targeting a longer 16S rRNA fragment was subsequently performed on the first round PCR amplicons of the positive samples. Further characterization using the heat-shock operon (groEL) gene was also performed on the A. platys-positive samples. RESULTS: 10 16S rRNA sequences were obtained and found 99.6-100% identical to each other and 99.6-99.7% identical to the closest registered A. platys sequences. On the other hand, 36 groEL clone sequences were obtained and found to be 85.1-99.8% identical with each other and 85.0-88.9% identical to the closest previously registered A. platys sequences. Four dogs were found coinfected with 2-3 groEL variant sequences. Phylogenetic analyses suggest that the detected A. platys in the Philippines may represent unique variants. CONCLUSION: A. platys variants were detected in Philippine dogs. Coinfection of different A. platys variants in dogs was also demonstrated. The present study may indicate the potential genetic diversity of A. platys in the country. Veterinary World 2016-12 2016-12-20 /pmc/articles/PMC5234063/ /pubmed/28096621 http://dx.doi.org/10.14202/vetworld.2016.1456-1460 Text en Copyright: © Ybañez, et al. http://creativecommons.org/licenses/by/4.0 Open Access. This article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated. |
spellingShingle | Research Article Ybañez, Adrian Patalinghug Ybañez, Rochelle Haidee Daclan Yokoyama, Naoaki Inokuma, Hisashi Multiple infections of Anaplasma platys variants in Philippine dogs |
title | Multiple infections of Anaplasma platys variants in Philippine dogs |
title_full | Multiple infections of Anaplasma platys variants in Philippine dogs |
title_fullStr | Multiple infections of Anaplasma platys variants in Philippine dogs |
title_full_unstemmed | Multiple infections of Anaplasma platys variants in Philippine dogs |
title_short | Multiple infections of Anaplasma platys variants in Philippine dogs |
title_sort | multiple infections of anaplasma platys variants in philippine dogs |
topic | Research Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5234063/ https://www.ncbi.nlm.nih.gov/pubmed/28096621 http://dx.doi.org/10.14202/vetworld.2016.1456-1460 |
work_keys_str_mv | AT ybanezadrianpatalinghug multipleinfectionsofanaplasmaplatysvariantsinphilippinedogs AT ybanezrochellehaideedaclan multipleinfectionsofanaplasmaplatysvariantsinphilippinedogs AT yokoyamanaoaki multipleinfectionsofanaplasmaplatysvariantsinphilippinedogs AT inokumahisashi multipleinfectionsofanaplasmaplatysvariantsinphilippinedogs |