Cargando…
Short stature and hypoparathyroidism in a child with Kenny-Caffey syndrome type 2 due to a novel mutation in FAM111A gene
BACKGROUND: Hypoparathyroidism in children is a heterogeneous group with diverse genetic etiologies. To aid clinicians in the investigation and management of children with hypoparathyroidism, we describe the phenotype of a 6-year-old child with hypoparathyroidism and short stature diagnosed with Ken...
Autores principales: | , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2017
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5264330/ https://www.ncbi.nlm.nih.gov/pubmed/28138333 http://dx.doi.org/10.1186/s13633-016-0041-7 |
_version_ | 1782500084532903936 |
---|---|
author | Abraham, Mary B. Li, Dong Tang, Dave O’Connell, Susan M. McKenzie, Fiona Lim, Ee Mun Hakonarson, Hakon Levine, Michael A. Choong, Catherine S. |
author_facet | Abraham, Mary B. Li, Dong Tang, Dave O’Connell, Susan M. McKenzie, Fiona Lim, Ee Mun Hakonarson, Hakon Levine, Michael A. Choong, Catherine S. |
author_sort | Abraham, Mary B. |
collection | PubMed |
description | BACKGROUND: Hypoparathyroidism in children is a heterogeneous group with diverse genetic etiologies. To aid clinicians in the investigation and management of children with hypoparathyroidism, we describe the phenotype of a 6-year-old child with hypoparathyroidism and short stature diagnosed with Kenny-Caffey syndrome (KCS) Type 2 and the subsequent response to growth hormone (GH) treatment. CASE PRESENTATION: The proband presented in the neonatal period with hypocalcemic seizures secondary to hypoparathyroidism. Her phenotype included small hands and feet, hypoplastic and dystrophic nails, hypoplastic mid-face and macrocrania. Postnatal growth was delayed but neurodevelopment was normal. A skeletal survey at 2 years of age was suggestive of KCS Type 2 and genetic testing revealed a novel de novo heterozygous mutation c.1622C > A (p.Ser541Tyr) in FAM111A. At 3 years and 2 months, her height was 80cms (SDS −3.86). She had normal overnight GH levels. GH therapy was commenced at a dose of 4.9 mg/m(2)/week for her short stature and low height velocity of 5cms/year. At the end of the first and second years of GH treatment, height velocity was 6.5cms/year and 7.2cms/year, respectively with maximal dose of 7.24 mg/m(2)/week. CONCLUSION: This case highlights the phenotype and the limited response to GH in a child with genetically proven KCS type 2. Long-term registries monitoring growth outcomes following GH therapy in patients with rare genetic conditions may help guide clinical decisions regarding the use and doses of GH in these conditions. |
format | Online Article Text |
id | pubmed-5264330 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2017 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-52643302017-01-30 Short stature and hypoparathyroidism in a child with Kenny-Caffey syndrome type 2 due to a novel mutation in FAM111A gene Abraham, Mary B. Li, Dong Tang, Dave O’Connell, Susan M. McKenzie, Fiona Lim, Ee Mun Hakonarson, Hakon Levine, Michael A. Choong, Catherine S. Int J Pediatr Endocrinol Case Report BACKGROUND: Hypoparathyroidism in children is a heterogeneous group with diverse genetic etiologies. To aid clinicians in the investigation and management of children with hypoparathyroidism, we describe the phenotype of a 6-year-old child with hypoparathyroidism and short stature diagnosed with Kenny-Caffey syndrome (KCS) Type 2 and the subsequent response to growth hormone (GH) treatment. CASE PRESENTATION: The proband presented in the neonatal period with hypocalcemic seizures secondary to hypoparathyroidism. Her phenotype included small hands and feet, hypoplastic and dystrophic nails, hypoplastic mid-face and macrocrania. Postnatal growth was delayed but neurodevelopment was normal. A skeletal survey at 2 years of age was suggestive of KCS Type 2 and genetic testing revealed a novel de novo heterozygous mutation c.1622C > A (p.Ser541Tyr) in FAM111A. At 3 years and 2 months, her height was 80cms (SDS −3.86). She had normal overnight GH levels. GH therapy was commenced at a dose of 4.9 mg/m(2)/week for her short stature and low height velocity of 5cms/year. At the end of the first and second years of GH treatment, height velocity was 6.5cms/year and 7.2cms/year, respectively with maximal dose of 7.24 mg/m(2)/week. CONCLUSION: This case highlights the phenotype and the limited response to GH in a child with genetically proven KCS type 2. Long-term registries monitoring growth outcomes following GH therapy in patients with rare genetic conditions may help guide clinical decisions regarding the use and doses of GH in these conditions. BioMed Central 2017-01-25 2017 /pmc/articles/PMC5264330/ /pubmed/28138333 http://dx.doi.org/10.1186/s13633-016-0041-7 Text en © The Author(s). 2017 Open AccessThis article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated. |
spellingShingle | Case Report Abraham, Mary B. Li, Dong Tang, Dave O’Connell, Susan M. McKenzie, Fiona Lim, Ee Mun Hakonarson, Hakon Levine, Michael A. Choong, Catherine S. Short stature and hypoparathyroidism in a child with Kenny-Caffey syndrome type 2 due to a novel mutation in FAM111A gene |
title | Short stature and hypoparathyroidism in a child with Kenny-Caffey syndrome type 2 due to a novel mutation in FAM111A gene |
title_full | Short stature and hypoparathyroidism in a child with Kenny-Caffey syndrome type 2 due to a novel mutation in FAM111A gene |
title_fullStr | Short stature and hypoparathyroidism in a child with Kenny-Caffey syndrome type 2 due to a novel mutation in FAM111A gene |
title_full_unstemmed | Short stature and hypoparathyroidism in a child with Kenny-Caffey syndrome type 2 due to a novel mutation in FAM111A gene |
title_short | Short stature and hypoparathyroidism in a child with Kenny-Caffey syndrome type 2 due to a novel mutation in FAM111A gene |
title_sort | short stature and hypoparathyroidism in a child with kenny-caffey syndrome type 2 due to a novel mutation in fam111a gene |
topic | Case Report |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5264330/ https://www.ncbi.nlm.nih.gov/pubmed/28138333 http://dx.doi.org/10.1186/s13633-016-0041-7 |
work_keys_str_mv | AT abrahammaryb shortstatureandhypoparathyroidisminachildwithkennycaffeysyndrometype2duetoanovelmutationinfam111agene AT lidong shortstatureandhypoparathyroidisminachildwithkennycaffeysyndrometype2duetoanovelmutationinfam111agene AT tangdave shortstatureandhypoparathyroidisminachildwithkennycaffeysyndrometype2duetoanovelmutationinfam111agene AT oconnellsusanm shortstatureandhypoparathyroidisminachildwithkennycaffeysyndrometype2duetoanovelmutationinfam111agene AT mckenziefiona shortstatureandhypoparathyroidisminachildwithkennycaffeysyndrometype2duetoanovelmutationinfam111agene AT limeemun shortstatureandhypoparathyroidisminachildwithkennycaffeysyndrometype2duetoanovelmutationinfam111agene AT hakonarsonhakon shortstatureandhypoparathyroidisminachildwithkennycaffeysyndrometype2duetoanovelmutationinfam111agene AT levinemichaela shortstatureandhypoparathyroidisminachildwithkennycaffeysyndrometype2duetoanovelmutationinfam111agene AT choongcatherines shortstatureandhypoparathyroidisminachildwithkennycaffeysyndrometype2duetoanovelmutationinfam111agene |