Cargando…

Short stature and hypoparathyroidism in a child with Kenny-Caffey syndrome type 2 due to a novel mutation in FAM111A gene

BACKGROUND: Hypoparathyroidism in children is a heterogeneous group with diverse genetic etiologies. To aid clinicians in the investigation and management of children with hypoparathyroidism, we describe the phenotype of a 6-year-old child with hypoparathyroidism and short stature diagnosed with Ken...

Descripción completa

Detalles Bibliográficos
Autores principales: Abraham, Mary B., Li, Dong, Tang, Dave, O’Connell, Susan M., McKenzie, Fiona, Lim, Ee Mun, Hakonarson, Hakon, Levine, Michael A., Choong, Catherine S.
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2017
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5264330/
https://www.ncbi.nlm.nih.gov/pubmed/28138333
http://dx.doi.org/10.1186/s13633-016-0041-7
_version_ 1782500084532903936
author Abraham, Mary B.
Li, Dong
Tang, Dave
O’Connell, Susan M.
McKenzie, Fiona
Lim, Ee Mun
Hakonarson, Hakon
Levine, Michael A.
Choong, Catherine S.
author_facet Abraham, Mary B.
Li, Dong
Tang, Dave
O’Connell, Susan M.
McKenzie, Fiona
Lim, Ee Mun
Hakonarson, Hakon
Levine, Michael A.
Choong, Catherine S.
author_sort Abraham, Mary B.
collection PubMed
description BACKGROUND: Hypoparathyroidism in children is a heterogeneous group with diverse genetic etiologies. To aid clinicians in the investigation and management of children with hypoparathyroidism, we describe the phenotype of a 6-year-old child with hypoparathyroidism and short stature diagnosed with Kenny-Caffey syndrome (KCS) Type 2 and the subsequent response to growth hormone (GH) treatment. CASE PRESENTATION: The proband presented in the neonatal period with hypocalcemic seizures secondary to hypoparathyroidism. Her phenotype included small hands and feet, hypoplastic and dystrophic nails, hypoplastic mid-face and macrocrania. Postnatal growth was delayed but neurodevelopment was normal. A skeletal survey at 2 years of age was suggestive of KCS Type 2 and genetic testing revealed a novel de novo heterozygous mutation c.1622C > A (p.Ser541Tyr) in FAM111A. At 3 years and 2 months, her height was 80cms (SDS −3.86). She had normal overnight GH levels. GH therapy was commenced at a dose of 4.9 mg/m(2)/week for her short stature and low height velocity of 5cms/year. At the end of the first and second years of GH treatment, height velocity was 6.5cms/year and 7.2cms/year, respectively with maximal dose of 7.24 mg/m(2)/week. CONCLUSION: This case highlights the phenotype and the limited response to GH in a child with genetically proven KCS type 2. Long-term registries monitoring growth outcomes following GH therapy in patients with rare genetic conditions may help guide clinical decisions regarding the use and doses of GH in these conditions.
format Online
Article
Text
id pubmed-5264330
institution National Center for Biotechnology Information
language English
publishDate 2017
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-52643302017-01-30 Short stature and hypoparathyroidism in a child with Kenny-Caffey syndrome type 2 due to a novel mutation in FAM111A gene Abraham, Mary B. Li, Dong Tang, Dave O’Connell, Susan M. McKenzie, Fiona Lim, Ee Mun Hakonarson, Hakon Levine, Michael A. Choong, Catherine S. Int J Pediatr Endocrinol Case Report BACKGROUND: Hypoparathyroidism in children is a heterogeneous group with diverse genetic etiologies. To aid clinicians in the investigation and management of children with hypoparathyroidism, we describe the phenotype of a 6-year-old child with hypoparathyroidism and short stature diagnosed with Kenny-Caffey syndrome (KCS) Type 2 and the subsequent response to growth hormone (GH) treatment. CASE PRESENTATION: The proband presented in the neonatal period with hypocalcemic seizures secondary to hypoparathyroidism. Her phenotype included small hands and feet, hypoplastic and dystrophic nails, hypoplastic mid-face and macrocrania. Postnatal growth was delayed but neurodevelopment was normal. A skeletal survey at 2 years of age was suggestive of KCS Type 2 and genetic testing revealed a novel de novo heterozygous mutation c.1622C > A (p.Ser541Tyr) in FAM111A. At 3 years and 2 months, her height was 80cms (SDS −3.86). She had normal overnight GH levels. GH therapy was commenced at a dose of 4.9 mg/m(2)/week for her short stature and low height velocity of 5cms/year. At the end of the first and second years of GH treatment, height velocity was 6.5cms/year and 7.2cms/year, respectively with maximal dose of 7.24 mg/m(2)/week. CONCLUSION: This case highlights the phenotype and the limited response to GH in a child with genetically proven KCS type 2. Long-term registries monitoring growth outcomes following GH therapy in patients with rare genetic conditions may help guide clinical decisions regarding the use and doses of GH in these conditions. BioMed Central 2017-01-25 2017 /pmc/articles/PMC5264330/ /pubmed/28138333 http://dx.doi.org/10.1186/s13633-016-0041-7 Text en © The Author(s). 2017 Open AccessThis article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated.
spellingShingle Case Report
Abraham, Mary B.
Li, Dong
Tang, Dave
O’Connell, Susan M.
McKenzie, Fiona
Lim, Ee Mun
Hakonarson, Hakon
Levine, Michael A.
Choong, Catherine S.
Short stature and hypoparathyroidism in a child with Kenny-Caffey syndrome type 2 due to a novel mutation in FAM111A gene
title Short stature and hypoparathyroidism in a child with Kenny-Caffey syndrome type 2 due to a novel mutation in FAM111A gene
title_full Short stature and hypoparathyroidism in a child with Kenny-Caffey syndrome type 2 due to a novel mutation in FAM111A gene
title_fullStr Short stature and hypoparathyroidism in a child with Kenny-Caffey syndrome type 2 due to a novel mutation in FAM111A gene
title_full_unstemmed Short stature and hypoparathyroidism in a child with Kenny-Caffey syndrome type 2 due to a novel mutation in FAM111A gene
title_short Short stature and hypoparathyroidism in a child with Kenny-Caffey syndrome type 2 due to a novel mutation in FAM111A gene
title_sort short stature and hypoparathyroidism in a child with kenny-caffey syndrome type 2 due to a novel mutation in fam111a gene
topic Case Report
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5264330/
https://www.ncbi.nlm.nih.gov/pubmed/28138333
http://dx.doi.org/10.1186/s13633-016-0041-7
work_keys_str_mv AT abrahammaryb shortstatureandhypoparathyroidisminachildwithkennycaffeysyndrometype2duetoanovelmutationinfam111agene
AT lidong shortstatureandhypoparathyroidisminachildwithkennycaffeysyndrometype2duetoanovelmutationinfam111agene
AT tangdave shortstatureandhypoparathyroidisminachildwithkennycaffeysyndrometype2duetoanovelmutationinfam111agene
AT oconnellsusanm shortstatureandhypoparathyroidisminachildwithkennycaffeysyndrometype2duetoanovelmutationinfam111agene
AT mckenziefiona shortstatureandhypoparathyroidisminachildwithkennycaffeysyndrometype2duetoanovelmutationinfam111agene
AT limeemun shortstatureandhypoparathyroidisminachildwithkennycaffeysyndrometype2duetoanovelmutationinfam111agene
AT hakonarsonhakon shortstatureandhypoparathyroidisminachildwithkennycaffeysyndrometype2duetoanovelmutationinfam111agene
AT levinemichaela shortstatureandhypoparathyroidisminachildwithkennycaffeysyndrometype2duetoanovelmutationinfam111agene
AT choongcatherines shortstatureandhypoparathyroidisminachildwithkennycaffeysyndrometype2duetoanovelmutationinfam111agene