Cargando…

Ultrasonic Shear Wave Elasticity Imaging (SWEI) Sequencing and Data Processing Using a Verasonics Research Scanner

Ultrasound elasticity imaging has been developed over the last decade to estimate tissue stiffness. Shear wave elasticity imaging (SWEI) quantifies tissue stiffness by measuring the speed of propagating shear waves following acoustic radiation force excitation. This work presents the sequencing and...

Descripción completa

Detalles Bibliográficos
Autores principales: Deng, Yufeng, Rouze, Ned C., Palmeri, Mark L., Nightingale, Kathryn R.
Formato: Online Artículo Texto
Lenguaje:English
Publicado: 2017
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5266610/
https://www.ncbi.nlm.nih.gov/pubmed/28092508
http://dx.doi.org/10.1109/TUFFC.2016.2614944
_version_ 1782500485618466816
author Deng, Yufeng
Rouze, Ned C.
Palmeri, Mark L.
Nightingale, Kathryn R.
author_facet Deng, Yufeng
Rouze, Ned C.
Palmeri, Mark L.
Nightingale, Kathryn R.
author_sort Deng, Yufeng
collection PubMed
description Ultrasound elasticity imaging has been developed over the last decade to estimate tissue stiffness. Shear wave elasticity imaging (SWEI) quantifies tissue stiffness by measuring the speed of propagating shear waves following acoustic radiation force excitation. This work presents the sequencing and data processing protocols of SWEI using a Verasonics system. The selection of the sequence parameters in a Verasonics programming script is discussed in detail. The data processing pipeline to calculate group shear wave speed (SWS), including tissue motion estimation, data filtering, and SWS estimation is demonstrated. In addition, the procedures for calibration of beam position, scanner timing, and transducer face heating are provided to avoid SWS measurement bias and transducer damage.
format Online
Article
Text
id pubmed-5266610
institution National Center for Biotechnology Information
language English
publishDate 2017
record_format MEDLINE/PubMed
spelling pubmed-52666102018-01-01 Ultrasonic Shear Wave Elasticity Imaging (SWEI) Sequencing and Data Processing Using a Verasonics Research Scanner Deng, Yufeng Rouze, Ned C. Palmeri, Mark L. Nightingale, Kathryn R. IEEE Trans Ultrason Ferroelectr Freq Control Article Ultrasound elasticity imaging has been developed over the last decade to estimate tissue stiffness. Shear wave elasticity imaging (SWEI) quantifies tissue stiffness by measuring the speed of propagating shear waves following acoustic radiation force excitation. This work presents the sequencing and data processing protocols of SWEI using a Verasonics system. The selection of the sequence parameters in a Verasonics programming script is discussed in detail. The data processing pipeline to calculate group shear wave speed (SWS), including tissue motion estimation, data filtering, and SWS estimation is demonstrated. In addition, the procedures for calibration of beam position, scanner timing, and transducer face heating are provided to avoid SWS measurement bias and transducer damage. 2017-01 /pmc/articles/PMC5266610/ /pubmed/28092508 http://dx.doi.org/10.1109/TUFFC.2016.2614944 Text en http://creativecommons.org/licenses/by/2.0/ Personal use is permitted, but republication/redistribution requires IEEE permission.
spellingShingle Article
Deng, Yufeng
Rouze, Ned C.
Palmeri, Mark L.
Nightingale, Kathryn R.
Ultrasonic Shear Wave Elasticity Imaging (SWEI) Sequencing and Data Processing Using a Verasonics Research Scanner
title Ultrasonic Shear Wave Elasticity Imaging (SWEI) Sequencing and Data Processing Using a Verasonics Research Scanner
title_full Ultrasonic Shear Wave Elasticity Imaging (SWEI) Sequencing and Data Processing Using a Verasonics Research Scanner
title_fullStr Ultrasonic Shear Wave Elasticity Imaging (SWEI) Sequencing and Data Processing Using a Verasonics Research Scanner
title_full_unstemmed Ultrasonic Shear Wave Elasticity Imaging (SWEI) Sequencing and Data Processing Using a Verasonics Research Scanner
title_short Ultrasonic Shear Wave Elasticity Imaging (SWEI) Sequencing and Data Processing Using a Verasonics Research Scanner
title_sort ultrasonic shear wave elasticity imaging (swei) sequencing and data processing using a verasonics research scanner
topic Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5266610/
https://www.ncbi.nlm.nih.gov/pubmed/28092508
http://dx.doi.org/10.1109/TUFFC.2016.2614944
work_keys_str_mv AT dengyufeng ultrasonicshearwaveelasticityimagingsweisequencinganddataprocessingusingaverasonicsresearchscanner
AT rouzenedc ultrasonicshearwaveelasticityimagingsweisequencinganddataprocessingusingaverasonicsresearchscanner
AT palmerimarkl ultrasonicshearwaveelasticityimagingsweisequencinganddataprocessingusingaverasonicsresearchscanner
AT nightingalekathrynr ultrasonicshearwaveelasticityimagingsweisequencinganddataprocessingusingaverasonicsresearchscanner