Cargando…
Ultrasonic Shear Wave Elasticity Imaging (SWEI) Sequencing and Data Processing Using a Verasonics Research Scanner
Ultrasound elasticity imaging has been developed over the last decade to estimate tissue stiffness. Shear wave elasticity imaging (SWEI) quantifies tissue stiffness by measuring the speed of propagating shear waves following acoustic radiation force excitation. This work presents the sequencing and...
Autores principales: | , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
2017
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5266610/ https://www.ncbi.nlm.nih.gov/pubmed/28092508 http://dx.doi.org/10.1109/TUFFC.2016.2614944 |
_version_ | 1782500485618466816 |
---|---|
author | Deng, Yufeng Rouze, Ned C. Palmeri, Mark L. Nightingale, Kathryn R. |
author_facet | Deng, Yufeng Rouze, Ned C. Palmeri, Mark L. Nightingale, Kathryn R. |
author_sort | Deng, Yufeng |
collection | PubMed |
description | Ultrasound elasticity imaging has been developed over the last decade to estimate tissue stiffness. Shear wave elasticity imaging (SWEI) quantifies tissue stiffness by measuring the speed of propagating shear waves following acoustic radiation force excitation. This work presents the sequencing and data processing protocols of SWEI using a Verasonics system. The selection of the sequence parameters in a Verasonics programming script is discussed in detail. The data processing pipeline to calculate group shear wave speed (SWS), including tissue motion estimation, data filtering, and SWS estimation is demonstrated. In addition, the procedures for calibration of beam position, scanner timing, and transducer face heating are provided to avoid SWS measurement bias and transducer damage. |
format | Online Article Text |
id | pubmed-5266610 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2017 |
record_format | MEDLINE/PubMed |
spelling | pubmed-52666102018-01-01 Ultrasonic Shear Wave Elasticity Imaging (SWEI) Sequencing and Data Processing Using a Verasonics Research Scanner Deng, Yufeng Rouze, Ned C. Palmeri, Mark L. Nightingale, Kathryn R. IEEE Trans Ultrason Ferroelectr Freq Control Article Ultrasound elasticity imaging has been developed over the last decade to estimate tissue stiffness. Shear wave elasticity imaging (SWEI) quantifies tissue stiffness by measuring the speed of propagating shear waves following acoustic radiation force excitation. This work presents the sequencing and data processing protocols of SWEI using a Verasonics system. The selection of the sequence parameters in a Verasonics programming script is discussed in detail. The data processing pipeline to calculate group shear wave speed (SWS), including tissue motion estimation, data filtering, and SWS estimation is demonstrated. In addition, the procedures for calibration of beam position, scanner timing, and transducer face heating are provided to avoid SWS measurement bias and transducer damage. 2017-01 /pmc/articles/PMC5266610/ /pubmed/28092508 http://dx.doi.org/10.1109/TUFFC.2016.2614944 Text en http://creativecommons.org/licenses/by/2.0/ Personal use is permitted, but republication/redistribution requires IEEE permission. |
spellingShingle | Article Deng, Yufeng Rouze, Ned C. Palmeri, Mark L. Nightingale, Kathryn R. Ultrasonic Shear Wave Elasticity Imaging (SWEI) Sequencing and Data Processing Using a Verasonics Research Scanner |
title | Ultrasonic Shear Wave Elasticity Imaging (SWEI) Sequencing and Data Processing Using a Verasonics Research Scanner |
title_full | Ultrasonic Shear Wave Elasticity Imaging (SWEI) Sequencing and Data Processing Using a Verasonics Research Scanner |
title_fullStr | Ultrasonic Shear Wave Elasticity Imaging (SWEI) Sequencing and Data Processing Using a Verasonics Research Scanner |
title_full_unstemmed | Ultrasonic Shear Wave Elasticity Imaging (SWEI) Sequencing and Data Processing Using a Verasonics Research Scanner |
title_short | Ultrasonic Shear Wave Elasticity Imaging (SWEI) Sequencing and Data Processing Using a Verasonics Research Scanner |
title_sort | ultrasonic shear wave elasticity imaging (swei) sequencing and data processing using a verasonics research scanner |
topic | Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5266610/ https://www.ncbi.nlm.nih.gov/pubmed/28092508 http://dx.doi.org/10.1109/TUFFC.2016.2614944 |
work_keys_str_mv | AT dengyufeng ultrasonicshearwaveelasticityimagingsweisequencinganddataprocessingusingaverasonicsresearchscanner AT rouzenedc ultrasonicshearwaveelasticityimagingsweisequencinganddataprocessingusingaverasonicsresearchscanner AT palmerimarkl ultrasonicshearwaveelasticityimagingsweisequencinganddataprocessingusingaverasonicsresearchscanner AT nightingalekathrynr ultrasonicshearwaveelasticityimagingsweisequencinganddataprocessingusingaverasonicsresearchscanner |