Cargando…
Erratum to: Factors affecting the exposure, vulnerability and emergency medical service capacity for victims of road traffic incidents in Kampala Metropolitan Area: a Delphi study
| Autores principales: | , , , , |
|---|---|
| Formato: | Online Artículo Texto |
| Lenguaje: | English |
| Publicado: |
BioMed Central
2017
|
| Materias: | |
| Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5267442/ https://www.ncbi.nlm.nih.gov/pubmed/28122490 http://dx.doi.org/10.1186/s12873-017-0115-8 |
| _version_ | 1782500641068810240 |
|---|---|
| author | Balikuddembe, Joseph Kimuli Ardalan, Ali Khorasani-Zavareh, Davoud Nejati, Amir Kasiima, Stephen |
| author_facet | Balikuddembe, Joseph Kimuli Ardalan, Ali Khorasani-Zavareh, Davoud Nejati, Amir Kasiima, Stephen |
| author_sort | Balikuddembe, Joseph Kimuli |
| collection | PubMed |
| description | |
| format | Online Article Text |
| id | pubmed-5267442 |
| institution | National Center for Biotechnology Information |
| language | English |
| publishDate | 2017 |
| publisher | BioMed Central |
| record_format | MEDLINE/PubMed |
| spelling | pubmed-52674422017-02-01 Erratum to: Factors affecting the exposure, vulnerability and emergency medical service capacity for victims of road traffic incidents in Kampala Metropolitan Area: a Delphi study Balikuddembe, Joseph Kimuli Ardalan, Ali Khorasani-Zavareh, Davoud Nejati, Amir Kasiima, Stephen BMC Emerg Med Erratum BioMed Central 2017-01-25 /pmc/articles/PMC5267442/ /pubmed/28122490 http://dx.doi.org/10.1186/s12873-017-0115-8 Text en © The Author(s). 2017 Open AccessThis article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated. |
| spellingShingle | Erratum Balikuddembe, Joseph Kimuli Ardalan, Ali Khorasani-Zavareh, Davoud Nejati, Amir Kasiima, Stephen Erratum to: Factors affecting the exposure, vulnerability and emergency medical service capacity for victims of road traffic incidents in Kampala Metropolitan Area: a Delphi study |
| title | Erratum to: Factors affecting the exposure, vulnerability and emergency medical service capacity for victims of road traffic incidents in Kampala Metropolitan Area: a Delphi study |
| title_full | Erratum to: Factors affecting the exposure, vulnerability and emergency medical service capacity for victims of road traffic incidents in Kampala Metropolitan Area: a Delphi study |
| title_fullStr | Erratum to: Factors affecting the exposure, vulnerability and emergency medical service capacity for victims of road traffic incidents in Kampala Metropolitan Area: a Delphi study |
| title_full_unstemmed | Erratum to: Factors affecting the exposure, vulnerability and emergency medical service capacity for victims of road traffic incidents in Kampala Metropolitan Area: a Delphi study |
| title_short | Erratum to: Factors affecting the exposure, vulnerability and emergency medical service capacity for victims of road traffic incidents in Kampala Metropolitan Area: a Delphi study |
| title_sort | erratum to: factors affecting the exposure, vulnerability and emergency medical service capacity for victims of road traffic incidents in kampala metropolitan area: a delphi study |
| topic | Erratum |
| url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5267442/ https://www.ncbi.nlm.nih.gov/pubmed/28122490 http://dx.doi.org/10.1186/s12873-017-0115-8 |
| work_keys_str_mv | AT balikuddembejosephkimuli erratumtofactorsaffectingtheexposurevulnerabilityandemergencymedicalservicecapacityforvictimsofroadtrafficincidentsinkampalametropolitanareaadelphistudy AT ardalanali erratumtofactorsaffectingtheexposurevulnerabilityandemergencymedicalservicecapacityforvictimsofroadtrafficincidentsinkampalametropolitanareaadelphistudy AT khorasanizavarehdavoud erratumtofactorsaffectingtheexposurevulnerabilityandemergencymedicalservicecapacityforvictimsofroadtrafficincidentsinkampalametropolitanareaadelphistudy AT nejatiamir erratumtofactorsaffectingtheexposurevulnerabilityandemergencymedicalservicecapacityforvictimsofroadtrafficincidentsinkampalametropolitanareaadelphistudy AT kasiimastephen erratumtofactorsaffectingtheexposurevulnerabilityandemergencymedicalservicecapacityforvictimsofroadtrafficincidentsinkampalametropolitanareaadelphistudy |