Cargando…
GDM-Induced Macrosomia Is Reversed by Cav-1 via AMPK-Mediated Fatty Acid Transport and GLUT1-Mediated Glucose Transport in Placenta
OBJECTIVE: To investigate if the role of Cav-1 in GDM-induced macrosomia is through regulating AMPK signaling pathway in placenta. METHODS: We used diagnostic criteria of gestational diabetes mellitus (GDM) and macrosomia to separate and compare placental protein and mRNA levels from GDM with macros...
Autores principales: | , , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Public Library of Science
2017
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5268469/ https://www.ncbi.nlm.nih.gov/pubmed/28125642 http://dx.doi.org/10.1371/journal.pone.0170490 |
_version_ | 1782500821273935872 |
---|---|
author | Yao, Guo Zhang, Yafang Wang, Di Yang, Ruirui Sang, Hui Han, Linlin Zhu, Yuexia Lu, Yanyan Tan, Yeke Shang, Zhanping |
author_facet | Yao, Guo Zhang, Yafang Wang, Di Yang, Ruirui Sang, Hui Han, Linlin Zhu, Yuexia Lu, Yanyan Tan, Yeke Shang, Zhanping |
author_sort | Yao, Guo |
collection | PubMed |
description | OBJECTIVE: To investigate if the role of Cav-1 in GDM-induced macrosomia is through regulating AMPK signaling pathway in placenta. METHODS: We used diagnostic criteria of gestational diabetes mellitus (GDM) and macrosomia to separate and compare placental protein and mRNA levels from GDM with macrosomia group (GDMM), GDM with normal birth weight group (GDMN) and normal glucose tolerance (NGT) with normal birth weight group (CON). Western blotting was performed to examine differentially expressed proteins of caveolin-1 (Cav-1) and Adenosine monophosphate-activated protein kinase (AMPK) signaling pathway related proteins, including phosphorylated-AMPKα(Thr172), AMPKα, phosphorylated-Acetyl-CoA carboxylase(Ser79) (p-ACC(Ser79)), ACC and glucose transporter 1 (GLUT1) in placenta between the three groups. The mRNA levels of Cav-1, AMPKα, ACC and GLUT1 in placenta were measured by real time-PCR. RESULTS: In the GDMM placenta group, both protein and mRNA levels of Cav-1 were down-regulated, while GLUT1 was up-regulated; the phosphorylation and mRNA levels of ACC and AMPKα were decreased, but total ACC protein levels were increased compared to both the GDMN (p<0.05) and CON groups (p<0.05). In GDMM placenta group, there was a significant negative correlation observed between neonatal birth weight (NBW) and protein expression levels of Cav-1, p-ACC(Ser79) and p-AMPKα(Thr172) (p<0.05), while positive relationship with ACC and GLUT1 protein levels. Besides, in GDMM group placental mRNA levels, NBW had a positive correlation with GLUT1 (p<0.05), while negative with Cav-1, AMPKα and ACC expression (p<0.05). Cav-1 protein expression was positively associated with p-AMPK and p-ACC (p<0.05), and negatively associated with GLUT1 (p<0.05). Interestingly, p-AMPK protein expression was closely related to p-ACC (p<0.05), but not with GLUT1. CONCLUSION: GDM-induced macrosomias have more severe inhibition of Cav-1 expression in placenta. Cav-1 is associated with placental glucose and fatty acid transport via the induction of AMPK signaling pathway and the reduction of GLUT1 signaling pathway to reverse GDM-induced macrosomia. |
format | Online Article Text |
id | pubmed-5268469 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2017 |
publisher | Public Library of Science |
record_format | MEDLINE/PubMed |
spelling | pubmed-52684692017-02-06 GDM-Induced Macrosomia Is Reversed by Cav-1 via AMPK-Mediated Fatty Acid Transport and GLUT1-Mediated Glucose Transport in Placenta Yao, Guo Zhang, Yafang Wang, Di Yang, Ruirui Sang, Hui Han, Linlin Zhu, Yuexia Lu, Yanyan Tan, Yeke Shang, Zhanping PLoS One Research Article OBJECTIVE: To investigate if the role of Cav-1 in GDM-induced macrosomia is through regulating AMPK signaling pathway in placenta. METHODS: We used diagnostic criteria of gestational diabetes mellitus (GDM) and macrosomia to separate and compare placental protein and mRNA levels from GDM with macrosomia group (GDMM), GDM with normal birth weight group (GDMN) and normal glucose tolerance (NGT) with normal birth weight group (CON). Western blotting was performed to examine differentially expressed proteins of caveolin-1 (Cav-1) and Adenosine monophosphate-activated protein kinase (AMPK) signaling pathway related proteins, including phosphorylated-AMPKα(Thr172), AMPKα, phosphorylated-Acetyl-CoA carboxylase(Ser79) (p-ACC(Ser79)), ACC and glucose transporter 1 (GLUT1) in placenta between the three groups. The mRNA levels of Cav-1, AMPKα, ACC and GLUT1 in placenta were measured by real time-PCR. RESULTS: In the GDMM placenta group, both protein and mRNA levels of Cav-1 were down-regulated, while GLUT1 was up-regulated; the phosphorylation and mRNA levels of ACC and AMPKα were decreased, but total ACC protein levels were increased compared to both the GDMN (p<0.05) and CON groups (p<0.05). In GDMM placenta group, there was a significant negative correlation observed between neonatal birth weight (NBW) and protein expression levels of Cav-1, p-ACC(Ser79) and p-AMPKα(Thr172) (p<0.05), while positive relationship with ACC and GLUT1 protein levels. Besides, in GDMM group placental mRNA levels, NBW had a positive correlation with GLUT1 (p<0.05), while negative with Cav-1, AMPKα and ACC expression (p<0.05). Cav-1 protein expression was positively associated with p-AMPK and p-ACC (p<0.05), and negatively associated with GLUT1 (p<0.05). Interestingly, p-AMPK protein expression was closely related to p-ACC (p<0.05), but not with GLUT1. CONCLUSION: GDM-induced macrosomias have more severe inhibition of Cav-1 expression in placenta. Cav-1 is associated with placental glucose and fatty acid transport via the induction of AMPK signaling pathway and the reduction of GLUT1 signaling pathway to reverse GDM-induced macrosomia. Public Library of Science 2017-01-26 /pmc/articles/PMC5268469/ /pubmed/28125642 http://dx.doi.org/10.1371/journal.pone.0170490 Text en © 2017 Yao et al http://creativecommons.org/licenses/by/4.0/ This is an open access article distributed under the terms of the Creative Commons Attribution License (http://creativecommons.org/licenses/by/4.0/) , which permits unrestricted use, distribution, and reproduction in any medium, provided the original author and source are credited. |
spellingShingle | Research Article Yao, Guo Zhang, Yafang Wang, Di Yang, Ruirui Sang, Hui Han, Linlin Zhu, Yuexia Lu, Yanyan Tan, Yeke Shang, Zhanping GDM-Induced Macrosomia Is Reversed by Cav-1 via AMPK-Mediated Fatty Acid Transport and GLUT1-Mediated Glucose Transport in Placenta |
title | GDM-Induced Macrosomia Is Reversed by Cav-1 via AMPK-Mediated Fatty Acid Transport and GLUT1-Mediated Glucose Transport in Placenta |
title_full | GDM-Induced Macrosomia Is Reversed by Cav-1 via AMPK-Mediated Fatty Acid Transport and GLUT1-Mediated Glucose Transport in Placenta |
title_fullStr | GDM-Induced Macrosomia Is Reversed by Cav-1 via AMPK-Mediated Fatty Acid Transport and GLUT1-Mediated Glucose Transport in Placenta |
title_full_unstemmed | GDM-Induced Macrosomia Is Reversed by Cav-1 via AMPK-Mediated Fatty Acid Transport and GLUT1-Mediated Glucose Transport in Placenta |
title_short | GDM-Induced Macrosomia Is Reversed by Cav-1 via AMPK-Mediated Fatty Acid Transport and GLUT1-Mediated Glucose Transport in Placenta |
title_sort | gdm-induced macrosomia is reversed by cav-1 via ampk-mediated fatty acid transport and glut1-mediated glucose transport in placenta |
topic | Research Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5268469/ https://www.ncbi.nlm.nih.gov/pubmed/28125642 http://dx.doi.org/10.1371/journal.pone.0170490 |
work_keys_str_mv | AT yaoguo gdminducedmacrosomiaisreversedbycav1viaampkmediatedfattyacidtransportandglut1mediatedglucosetransportinplacenta AT zhangyafang gdminducedmacrosomiaisreversedbycav1viaampkmediatedfattyacidtransportandglut1mediatedglucosetransportinplacenta AT wangdi gdminducedmacrosomiaisreversedbycav1viaampkmediatedfattyacidtransportandglut1mediatedglucosetransportinplacenta AT yangruirui gdminducedmacrosomiaisreversedbycav1viaampkmediatedfattyacidtransportandglut1mediatedglucosetransportinplacenta AT sanghui gdminducedmacrosomiaisreversedbycav1viaampkmediatedfattyacidtransportandglut1mediatedglucosetransportinplacenta AT hanlinlin gdminducedmacrosomiaisreversedbycav1viaampkmediatedfattyacidtransportandglut1mediatedglucosetransportinplacenta AT zhuyuexia gdminducedmacrosomiaisreversedbycav1viaampkmediatedfattyacidtransportandglut1mediatedglucosetransportinplacenta AT luyanyan gdminducedmacrosomiaisreversedbycav1viaampkmediatedfattyacidtransportandglut1mediatedglucosetransportinplacenta AT tanyeke gdminducedmacrosomiaisreversedbycav1viaampkmediatedfattyacidtransportandglut1mediatedglucosetransportinplacenta AT shangzhanping gdminducedmacrosomiaisreversedbycav1viaampkmediatedfattyacidtransportandglut1mediatedglucosetransportinplacenta |