Cargando…
Vaccination ecosystem health check: achieving impact today and sustainability for tomorrow
BACKGROUND: Vaccination is a complex ecosystem with several components that interact with one another and with the environment. Today’s vaccine ecosystem is defined by the pursuit of polio eradication, the drive to get as many of the new vaccines to as many people as possible and the research and de...
Autores principales: | , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2017
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5290488/ https://www.ncbi.nlm.nih.gov/pubmed/28677690 http://dx.doi.org/10.1186/s12919-016-0069-y |
_version_ | 1782504641604354048 |
---|---|
author | Saadatian-Elahi, Mitra Bloom, David Plotkin, Stanley Picot, Valentina Louis, Jacques Watson, Michael |
author_facet | Saadatian-Elahi, Mitra Bloom, David Plotkin, Stanley Picot, Valentina Louis, Jacques Watson, Michael |
author_sort | Saadatian-Elahi, Mitra |
collection | PubMed |
description | BACKGROUND: Vaccination is a complex ecosystem with several components that interact with one another and with the environment. Today’s vaccine ecosystem is defined by the pursuit of polio eradication, the drive to get as many of the new vaccines to as many people as possible and the research and development against immunologically challenging diseases. Despite these successes, vaccine ecosystem is facing keys issues with regard to supply/distribution and cost/profitability asymmetry that risk slowing its global growth. The conference “Vaccination ecosystem health check: achieving impact today and sustainability for tomorrow” held in Annecy-France (January 19–21, 2015) took stock of the health of today’s vaccination ecosystem and its ability to reliably and sustainably supply high-quality vaccines while investing in tomorrow’s needed innovation. MAIN FINDINGS: Small and decreasing numbers of suppliers/manufacturing facilities; paucity of research-driven companies; regulatory pressures; market uncertainties; political prioritization; anti-vaccine movements/complacency; and technological and programmatic issues were acknowledged as the major challenges that could weaken today’s vaccination ecosystem. The expert panel discussed also drivers and barriers to a sustainable vaccination ecosystem; the metrics of a vaccination ecosystem; and what should be added, removed, increased, or reduced to maintain the health of the vaccination ecosystem. ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (doi:10.1186/s12919-016-0069-y) contains supplementary material, which is available to authorized users. |
format | Online Article Text |
id | pubmed-5290488 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2017 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-52904882017-02-09 Vaccination ecosystem health check: achieving impact today and sustainability for tomorrow Saadatian-Elahi, Mitra Bloom, David Plotkin, Stanley Picot, Valentina Louis, Jacques Watson, Michael BMC Proc Meeting Report BACKGROUND: Vaccination is a complex ecosystem with several components that interact with one another and with the environment. Today’s vaccine ecosystem is defined by the pursuit of polio eradication, the drive to get as many of the new vaccines to as many people as possible and the research and development against immunologically challenging diseases. Despite these successes, vaccine ecosystem is facing keys issues with regard to supply/distribution and cost/profitability asymmetry that risk slowing its global growth. The conference “Vaccination ecosystem health check: achieving impact today and sustainability for tomorrow” held in Annecy-France (January 19–21, 2015) took stock of the health of today’s vaccination ecosystem and its ability to reliably and sustainably supply high-quality vaccines while investing in tomorrow’s needed innovation. MAIN FINDINGS: Small and decreasing numbers of suppliers/manufacturing facilities; paucity of research-driven companies; regulatory pressures; market uncertainties; political prioritization; anti-vaccine movements/complacency; and technological and programmatic issues were acknowledged as the major challenges that could weaken today’s vaccination ecosystem. The expert panel discussed also drivers and barriers to a sustainable vaccination ecosystem; the metrics of a vaccination ecosystem; and what should be added, removed, increased, or reduced to maintain the health of the vaccination ecosystem. ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (doi:10.1186/s12919-016-0069-y) contains supplementary material, which is available to authorized users. BioMed Central 2017-01-27 /pmc/articles/PMC5290488/ /pubmed/28677690 http://dx.doi.org/10.1186/s12919-016-0069-y Text en © The Author(s). 2017 Open AccessThis article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated. |
spellingShingle | Meeting Report Saadatian-Elahi, Mitra Bloom, David Plotkin, Stanley Picot, Valentina Louis, Jacques Watson, Michael Vaccination ecosystem health check: achieving impact today and sustainability for tomorrow |
title | Vaccination ecosystem health check: achieving impact today and sustainability for tomorrow |
title_full | Vaccination ecosystem health check: achieving impact today and sustainability for tomorrow |
title_fullStr | Vaccination ecosystem health check: achieving impact today and sustainability for tomorrow |
title_full_unstemmed | Vaccination ecosystem health check: achieving impact today and sustainability for tomorrow |
title_short | Vaccination ecosystem health check: achieving impact today and sustainability for tomorrow |
title_sort | vaccination ecosystem health check: achieving impact today and sustainability for tomorrow |
topic | Meeting Report |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5290488/ https://www.ncbi.nlm.nih.gov/pubmed/28677690 http://dx.doi.org/10.1186/s12919-016-0069-y |
work_keys_str_mv | AT saadatianelahimitra vaccinationecosystemhealthcheckachievingimpacttodayandsustainabilityfortomorrow AT bloomdavid vaccinationecosystemhealthcheckachievingimpacttodayandsustainabilityfortomorrow AT plotkinstanley vaccinationecosystemhealthcheckachievingimpacttodayandsustainabilityfortomorrow AT picotvalentina vaccinationecosystemhealthcheckachievingimpacttodayandsustainabilityfortomorrow AT louisjacques vaccinationecosystemhealthcheckachievingimpacttodayandsustainabilityfortomorrow AT watsonmichael vaccinationecosystemhealthcheckachievingimpacttodayandsustainabilityfortomorrow |