Cargando…

Efficacy of Memantine in Schizophrenic Patients: A Systematic Review

Several evidences support the hypothesis that glutamatergic dysfunction may be implicated in the pathogenesis of schizophrenia and in the last few years great interest has been focused on the role of the N-methyl-D-aspartate receptor (NMDAR). Glutamate is the main excitatory neurotransmitter in huma...

Descripción completa

Detalles Bibliográficos
Autores principales: Di Iorio, Giuseppe, Baroni, Gaia, Lorusso, Marco, Montemitro, Chiara, Spano, Maria Chiara, di Giannantonio, Massimo
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Hindawi Publishing Corporation 2017
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5294374/
https://www.ncbi.nlm.nih.gov/pubmed/28243470
http://dx.doi.org/10.1155/2017/7021071
_version_ 1782505227365122048
author Di Iorio, Giuseppe
Baroni, Gaia
Lorusso, Marco
Montemitro, Chiara
Spano, Maria Chiara
di Giannantonio, Massimo
author_facet Di Iorio, Giuseppe
Baroni, Gaia
Lorusso, Marco
Montemitro, Chiara
Spano, Maria Chiara
di Giannantonio, Massimo
author_sort Di Iorio, Giuseppe
collection PubMed
description Several evidences support the hypothesis that glutamatergic dysfunction may be implicated in the pathogenesis of schizophrenia and in the last few years great interest has been focused on the role of the N-methyl-D-aspartate receptor (NMDAR). Glutamate is the main excitatory neurotransmitter in human CNS and it plays a prominent role in synaptic plasticity, learning, and memory and other cognitive functions. Increasing interest in memantine add-on therapy in schizophrenic patients with negative and cognitive symptoms may suggest that memantine could be a new promising treatment in schizophrenia. The aim of this update was to evaluate clinical data about the memantine effectiveness in schizophrenic patients. Our systematic review of the literature highlights that memantine therapy in schizophrenic patients seems to improve mainly negative symptoms while positive symptoms and cognitive symptoms did not improve significantly.
format Online
Article
Text
id pubmed-5294374
institution National Center for Biotechnology Information
language English
publishDate 2017
publisher Hindawi Publishing Corporation
record_format MEDLINE/PubMed
spelling pubmed-52943742017-02-27 Efficacy of Memantine in Schizophrenic Patients: A Systematic Review Di Iorio, Giuseppe Baroni, Gaia Lorusso, Marco Montemitro, Chiara Spano, Maria Chiara di Giannantonio, Massimo J Amino Acids Review Article Several evidences support the hypothesis that glutamatergic dysfunction may be implicated in the pathogenesis of schizophrenia and in the last few years great interest has been focused on the role of the N-methyl-D-aspartate receptor (NMDAR). Glutamate is the main excitatory neurotransmitter in human CNS and it plays a prominent role in synaptic plasticity, learning, and memory and other cognitive functions. Increasing interest in memantine add-on therapy in schizophrenic patients with negative and cognitive symptoms may suggest that memantine could be a new promising treatment in schizophrenia. The aim of this update was to evaluate clinical data about the memantine effectiveness in schizophrenic patients. Our systematic review of the literature highlights that memantine therapy in schizophrenic patients seems to improve mainly negative symptoms while positive symptoms and cognitive symptoms did not improve significantly. Hindawi Publishing Corporation 2017 2017-01-24 /pmc/articles/PMC5294374/ /pubmed/28243470 http://dx.doi.org/10.1155/2017/7021071 Text en Copyright © 2017 Giuseppe Di Iorio et al. https://creativecommons.org/licenses/by/4.0/ This is an open access article distributed under the Creative Commons Attribution License, which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited.
spellingShingle Review Article
Di Iorio, Giuseppe
Baroni, Gaia
Lorusso, Marco
Montemitro, Chiara
Spano, Maria Chiara
di Giannantonio, Massimo
Efficacy of Memantine in Schizophrenic Patients: A Systematic Review
title Efficacy of Memantine in Schizophrenic Patients: A Systematic Review
title_full Efficacy of Memantine in Schizophrenic Patients: A Systematic Review
title_fullStr Efficacy of Memantine in Schizophrenic Patients: A Systematic Review
title_full_unstemmed Efficacy of Memantine in Schizophrenic Patients: A Systematic Review
title_short Efficacy of Memantine in Schizophrenic Patients: A Systematic Review
title_sort efficacy of memantine in schizophrenic patients: a systematic review
topic Review Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5294374/
https://www.ncbi.nlm.nih.gov/pubmed/28243470
http://dx.doi.org/10.1155/2017/7021071
work_keys_str_mv AT diioriogiuseppe efficacyofmemantineinschizophrenicpatientsasystematicreview
AT baronigaia efficacyofmemantineinschizophrenicpatientsasystematicreview
AT lorussomarco efficacyofmemantineinschizophrenicpatientsasystematicreview
AT montemitrochiara efficacyofmemantineinschizophrenicpatientsasystematicreview
AT spanomariachiara efficacyofmemantineinschizophrenicpatientsasystematicreview
AT digiannantoniomassimo efficacyofmemantineinschizophrenicpatientsasystematicreview