Cargando…
Efficacy of Memantine in Schizophrenic Patients: A Systematic Review
Several evidences support the hypothesis that glutamatergic dysfunction may be implicated in the pathogenesis of schizophrenia and in the last few years great interest has been focused on the role of the N-methyl-D-aspartate receptor (NMDAR). Glutamate is the main excitatory neurotransmitter in huma...
Autores principales: | , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Hindawi Publishing Corporation
2017
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5294374/ https://www.ncbi.nlm.nih.gov/pubmed/28243470 http://dx.doi.org/10.1155/2017/7021071 |
_version_ | 1782505227365122048 |
---|---|
author | Di Iorio, Giuseppe Baroni, Gaia Lorusso, Marco Montemitro, Chiara Spano, Maria Chiara di Giannantonio, Massimo |
author_facet | Di Iorio, Giuseppe Baroni, Gaia Lorusso, Marco Montemitro, Chiara Spano, Maria Chiara di Giannantonio, Massimo |
author_sort | Di Iorio, Giuseppe |
collection | PubMed |
description | Several evidences support the hypothesis that glutamatergic dysfunction may be implicated in the pathogenesis of schizophrenia and in the last few years great interest has been focused on the role of the N-methyl-D-aspartate receptor (NMDAR). Glutamate is the main excitatory neurotransmitter in human CNS and it plays a prominent role in synaptic plasticity, learning, and memory and other cognitive functions. Increasing interest in memantine add-on therapy in schizophrenic patients with negative and cognitive symptoms may suggest that memantine could be a new promising treatment in schizophrenia. The aim of this update was to evaluate clinical data about the memantine effectiveness in schizophrenic patients. Our systematic review of the literature highlights that memantine therapy in schizophrenic patients seems to improve mainly negative symptoms while positive symptoms and cognitive symptoms did not improve significantly. |
format | Online Article Text |
id | pubmed-5294374 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2017 |
publisher | Hindawi Publishing Corporation |
record_format | MEDLINE/PubMed |
spelling | pubmed-52943742017-02-27 Efficacy of Memantine in Schizophrenic Patients: A Systematic Review Di Iorio, Giuseppe Baroni, Gaia Lorusso, Marco Montemitro, Chiara Spano, Maria Chiara di Giannantonio, Massimo J Amino Acids Review Article Several evidences support the hypothesis that glutamatergic dysfunction may be implicated in the pathogenesis of schizophrenia and in the last few years great interest has been focused on the role of the N-methyl-D-aspartate receptor (NMDAR). Glutamate is the main excitatory neurotransmitter in human CNS and it plays a prominent role in synaptic plasticity, learning, and memory and other cognitive functions. Increasing interest in memantine add-on therapy in schizophrenic patients with negative and cognitive symptoms may suggest that memantine could be a new promising treatment in schizophrenia. The aim of this update was to evaluate clinical data about the memantine effectiveness in schizophrenic patients. Our systematic review of the literature highlights that memantine therapy in schizophrenic patients seems to improve mainly negative symptoms while positive symptoms and cognitive symptoms did not improve significantly. Hindawi Publishing Corporation 2017 2017-01-24 /pmc/articles/PMC5294374/ /pubmed/28243470 http://dx.doi.org/10.1155/2017/7021071 Text en Copyright © 2017 Giuseppe Di Iorio et al. https://creativecommons.org/licenses/by/4.0/ This is an open access article distributed under the Creative Commons Attribution License, which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited. |
spellingShingle | Review Article Di Iorio, Giuseppe Baroni, Gaia Lorusso, Marco Montemitro, Chiara Spano, Maria Chiara di Giannantonio, Massimo Efficacy of Memantine in Schizophrenic Patients: A Systematic Review |
title | Efficacy of Memantine in Schizophrenic Patients: A Systematic Review |
title_full | Efficacy of Memantine in Schizophrenic Patients: A Systematic Review |
title_fullStr | Efficacy of Memantine in Schizophrenic Patients: A Systematic Review |
title_full_unstemmed | Efficacy of Memantine in Schizophrenic Patients: A Systematic Review |
title_short | Efficacy of Memantine in Schizophrenic Patients: A Systematic Review |
title_sort | efficacy of memantine in schizophrenic patients: a systematic review |
topic | Review Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5294374/ https://www.ncbi.nlm.nih.gov/pubmed/28243470 http://dx.doi.org/10.1155/2017/7021071 |
work_keys_str_mv | AT diioriogiuseppe efficacyofmemantineinschizophrenicpatientsasystematicreview AT baronigaia efficacyofmemantineinschizophrenicpatientsasystematicreview AT lorussomarco efficacyofmemantineinschizophrenicpatientsasystematicreview AT montemitrochiara efficacyofmemantineinschizophrenicpatientsasystematicreview AT spanomariachiara efficacyofmemantineinschizophrenicpatientsasystematicreview AT digiannantoniomassimo efficacyofmemantineinschizophrenicpatientsasystematicreview |