Cargando…
Peginterferon beta-1a improves MRI measures and increases the proportion of patients with no evidence of disease activity in relapsing-remitting multiple sclerosis: 2-year results from the ADVANCE randomized controlled trial
BACKGROUND: Subcutaneous peginterferon beta-1a has previously been shown to reduce the number of T2-hyperintense and gadolinium-enhancing (Gd+) lesions over 2 years in patients with relapsing-remitting multiple sclerosis (RRMS), and to reduce T1-hypointense lesion formation and the proportion of pat...
Autores principales: | , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2017
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5301356/ https://www.ncbi.nlm.nih.gov/pubmed/28183276 http://dx.doi.org/10.1186/s12883-017-0799-0 |
_version_ | 1782506347977244672 |
---|---|
author | Arnold, Douglas L. Calabresi, Peter A. Kieseier, Bernd C. Liu, Shifang You, Xiaojun Fiore, Damian Hung, Serena |
author_facet | Arnold, Douglas L. Calabresi, Peter A. Kieseier, Bernd C. Liu, Shifang You, Xiaojun Fiore, Damian Hung, Serena |
author_sort | Arnold, Douglas L. |
collection | PubMed |
description | BACKGROUND: Subcutaneous peginterferon beta-1a has previously been shown to reduce the number of T2-hyperintense and gadolinium-enhancing (Gd+) lesions over 2 years in patients with relapsing-remitting multiple sclerosis (RRMS), and to reduce T1-hypointense lesion formation and the proportion of patients showing evidence of disease activity, based on both clinical and radiological measures, compared with placebo over 1 year of treatment. The objectives of the current analyses were to evaluate T1 lesions and other magnetic resonance imaging (MRI) measures, including whole brain volume and magnetization transfer ratio (MTR) of normal appearing brain tissue (NABT), and the proportions of patients with no evidence of disease activity (NEDA), over 2 years. METHODS: Patients enrolled in the ADVANCE study received continuous peginterferon beta-1a every 2 or 4 weeks for 2 years, or delayed treatment (placebo in Year 1; peginterferon beta-1a every 2 or 4 weeks in Year 2). MRI scans were performed at baseline and Weeks 24, 48, and 96. Proportions of patients with NEDA were calculated based on radiological criteria (absence of Gd + and new/newly-enlarging T2 lesions) and clinical criteria (no relapse or confirmed disability progression) separately and overall. RESULTS: Peginterferon beta-1a every 2 weeks significantly reduced the number and volume of T1-hypointense lesions compared with delayed treatment over 2 years. Changes in whole brain volume and MTR of NABT were suggestive of pseudoatrophy during the first 6 months of peginterferon beta-1a treatment, which subsequently began to resolve. Significantly more patients in the peginterferon beta-1a every 2 weeks group compared with the delayed treatment group met MRI-NEDA criteria (41% vs 21%; odds ratio [OR] 2.56; p < 0.0001), clinical-NEDA criteria (71% vs 57%; OR 1.90; p < 0.0001) and achieved overall-NEDA (37% vs 16%; OR 3.09; p < 0.0001). CONCLUSION: Peginterferon beta-1a provides significant improvements in MRI measures and offers patients a good chance of remaining free from evidence of MRI, clinical and overall disease activity over a sustained 2-year period. TRIAL REGISTRATION: ClinicalTrials.gov: NCT00906399; Registered on: May 20, 2009. ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (doi:10.1186/s12883-017-0799-0) contains supplementary material, which is available to authorized users. |
format | Online Article Text |
id | pubmed-5301356 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2017 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-53013562017-02-15 Peginterferon beta-1a improves MRI measures and increases the proportion of patients with no evidence of disease activity in relapsing-remitting multiple sclerosis: 2-year results from the ADVANCE randomized controlled trial Arnold, Douglas L. Calabresi, Peter A. Kieseier, Bernd C. Liu, Shifang You, Xiaojun Fiore, Damian Hung, Serena BMC Neurol Research Article BACKGROUND: Subcutaneous peginterferon beta-1a has previously been shown to reduce the number of T2-hyperintense and gadolinium-enhancing (Gd+) lesions over 2 years in patients with relapsing-remitting multiple sclerosis (RRMS), and to reduce T1-hypointense lesion formation and the proportion of patients showing evidence of disease activity, based on both clinical and radiological measures, compared with placebo over 1 year of treatment. The objectives of the current analyses were to evaluate T1 lesions and other magnetic resonance imaging (MRI) measures, including whole brain volume and magnetization transfer ratio (MTR) of normal appearing brain tissue (NABT), and the proportions of patients with no evidence of disease activity (NEDA), over 2 years. METHODS: Patients enrolled in the ADVANCE study received continuous peginterferon beta-1a every 2 or 4 weeks for 2 years, or delayed treatment (placebo in Year 1; peginterferon beta-1a every 2 or 4 weeks in Year 2). MRI scans were performed at baseline and Weeks 24, 48, and 96. Proportions of patients with NEDA were calculated based on radiological criteria (absence of Gd + and new/newly-enlarging T2 lesions) and clinical criteria (no relapse or confirmed disability progression) separately and overall. RESULTS: Peginterferon beta-1a every 2 weeks significantly reduced the number and volume of T1-hypointense lesions compared with delayed treatment over 2 years. Changes in whole brain volume and MTR of NABT were suggestive of pseudoatrophy during the first 6 months of peginterferon beta-1a treatment, which subsequently began to resolve. Significantly more patients in the peginterferon beta-1a every 2 weeks group compared with the delayed treatment group met MRI-NEDA criteria (41% vs 21%; odds ratio [OR] 2.56; p < 0.0001), clinical-NEDA criteria (71% vs 57%; OR 1.90; p < 0.0001) and achieved overall-NEDA (37% vs 16%; OR 3.09; p < 0.0001). CONCLUSION: Peginterferon beta-1a provides significant improvements in MRI measures and offers patients a good chance of remaining free from evidence of MRI, clinical and overall disease activity over a sustained 2-year period. TRIAL REGISTRATION: ClinicalTrials.gov: NCT00906399; Registered on: May 20, 2009. ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (doi:10.1186/s12883-017-0799-0) contains supplementary material, which is available to authorized users. BioMed Central 2017-02-10 /pmc/articles/PMC5301356/ /pubmed/28183276 http://dx.doi.org/10.1186/s12883-017-0799-0 Text en © The Author(s). 2017 Open AccessThis article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated. |
spellingShingle | Research Article Arnold, Douglas L. Calabresi, Peter A. Kieseier, Bernd C. Liu, Shifang You, Xiaojun Fiore, Damian Hung, Serena Peginterferon beta-1a improves MRI measures and increases the proportion of patients with no evidence of disease activity in relapsing-remitting multiple sclerosis: 2-year results from the ADVANCE randomized controlled trial |
title | Peginterferon beta-1a improves MRI measures and increases the proportion of patients with no evidence of disease activity in relapsing-remitting multiple sclerosis: 2-year results from the ADVANCE randomized controlled trial |
title_full | Peginterferon beta-1a improves MRI measures and increases the proportion of patients with no evidence of disease activity in relapsing-remitting multiple sclerosis: 2-year results from the ADVANCE randomized controlled trial |
title_fullStr | Peginterferon beta-1a improves MRI measures and increases the proportion of patients with no evidence of disease activity in relapsing-remitting multiple sclerosis: 2-year results from the ADVANCE randomized controlled trial |
title_full_unstemmed | Peginterferon beta-1a improves MRI measures and increases the proportion of patients with no evidence of disease activity in relapsing-remitting multiple sclerosis: 2-year results from the ADVANCE randomized controlled trial |
title_short | Peginterferon beta-1a improves MRI measures and increases the proportion of patients with no evidence of disease activity in relapsing-remitting multiple sclerosis: 2-year results from the ADVANCE randomized controlled trial |
title_sort | peginterferon beta-1a improves mri measures and increases the proportion of patients with no evidence of disease activity in relapsing-remitting multiple sclerosis: 2-year results from the advance randomized controlled trial |
topic | Research Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5301356/ https://www.ncbi.nlm.nih.gov/pubmed/28183276 http://dx.doi.org/10.1186/s12883-017-0799-0 |
work_keys_str_mv | AT arnolddouglasl peginterferonbeta1aimprovesmrimeasuresandincreasestheproportionofpatientswithnoevidenceofdiseaseactivityinrelapsingremittingmultiplesclerosis2yearresultsfromtheadvancerandomizedcontrolledtrial AT calabresipetera peginterferonbeta1aimprovesmrimeasuresandincreasestheproportionofpatientswithnoevidenceofdiseaseactivityinrelapsingremittingmultiplesclerosis2yearresultsfromtheadvancerandomizedcontrolledtrial AT kieseierberndc peginterferonbeta1aimprovesmrimeasuresandincreasestheproportionofpatientswithnoevidenceofdiseaseactivityinrelapsingremittingmultiplesclerosis2yearresultsfromtheadvancerandomizedcontrolledtrial AT liushifang peginterferonbeta1aimprovesmrimeasuresandincreasestheproportionofpatientswithnoevidenceofdiseaseactivityinrelapsingremittingmultiplesclerosis2yearresultsfromtheadvancerandomizedcontrolledtrial AT youxiaojun peginterferonbeta1aimprovesmrimeasuresandincreasestheproportionofpatientswithnoevidenceofdiseaseactivityinrelapsingremittingmultiplesclerosis2yearresultsfromtheadvancerandomizedcontrolledtrial AT fioredamian peginterferonbeta1aimprovesmrimeasuresandincreasestheproportionofpatientswithnoevidenceofdiseaseactivityinrelapsingremittingmultiplesclerosis2yearresultsfromtheadvancerandomizedcontrolledtrial AT hungserena peginterferonbeta1aimprovesmrimeasuresandincreasestheproportionofpatientswithnoevidenceofdiseaseactivityinrelapsingremittingmultiplesclerosis2yearresultsfromtheadvancerandomizedcontrolledtrial |