Cargando…

From east to west across the Palearctic: Phylogeography of the invasive lime leaf miner Phyllonorycter issikii (Lepidoptera: Gracillariidae) and discovery of a putative new cryptic species in East Asia

Knowing the phylogeographic structure of invasive species is important for understanding the underlying processes of invasion. The micromoth Phyllonorycter issikii, whose larvae damage leaves of lime trees Tilia spp., was only known from East Asia. In the last three decades, it has been recorded in...

Descripción completa

Detalles Bibliográficos
Autores principales: Kirichenko, Natalia, Triberti, Paolo, Ohshima, Issei, Haran, Julien, Byun, Bong-Kyu, Li, Houhun, Augustin, Sylvie, Roques, Alain, Lopez-Vaamonde, Carlos
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Public Library of Science 2017
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5302804/
https://www.ncbi.nlm.nih.gov/pubmed/28187126
http://dx.doi.org/10.1371/journal.pone.0171104
_version_ 1782506616002707456
author Kirichenko, Natalia
Triberti, Paolo
Ohshima, Issei
Haran, Julien
Byun, Bong-Kyu
Li, Houhun
Augustin, Sylvie
Roques, Alain
Lopez-Vaamonde, Carlos
author_facet Kirichenko, Natalia
Triberti, Paolo
Ohshima, Issei
Haran, Julien
Byun, Bong-Kyu
Li, Houhun
Augustin, Sylvie
Roques, Alain
Lopez-Vaamonde, Carlos
author_sort Kirichenko, Natalia
collection PubMed
description Knowing the phylogeographic structure of invasive species is important for understanding the underlying processes of invasion. The micromoth Phyllonorycter issikii, whose larvae damage leaves of lime trees Tilia spp., was only known from East Asia. In the last three decades, it has been recorded in most of Europe, Western Russia and Siberia. We used the mitochondrial cytochrome c oxidase subunit I (COI) gene region to compare the genetic variability of P. issikii populations between these different regions. Additionally, we sequenced two nuclear genes (28S rRNA and Histone 3) and run morphometric analysis of male genitalia to probe for the existence of cryptic species. The analysis of COI data of 377 insect specimens collected in 16 countries across the Palearctic revealed the presence of two different lineages: P. issikii and a putative new cryptic Phyllonorycter species distributed in the Russian Far East and Japan. In P. issikii, we identified 31 haplotypes among which 23 were detected in the invaded area (Europe) and 10 were found in its putative native range in East Asia (Russian Far East, Japan, South Korea and China), with only two common haplotypes. The high number of haplotypes found in the invaded area suggest a possible scenario of multiple introductions. One haplotype H1 was dominant (119 individuals, 67.2%), not only throughout its expanding range in Europe and Siberia but, intriguingly, also in 96% of individuals originating from Japan. We detected eight unique haplotypes of P. issikii in East Asia. Five of them were exclusively found in the Russian Far East representing 95% of individuals from that area. The putative new cryptic Phyllonorycter species showed differences from P. issikii for the three studied genes. However, both species are morphologically undistinguishable. They occur in sympatry on the same host plants in Japan (Sendai) and the Russian Far East (Primorsky krai) without evidence of admixture.
format Online
Article
Text
id pubmed-5302804
institution National Center for Biotechnology Information
language English
publishDate 2017
publisher Public Library of Science
record_format MEDLINE/PubMed
spelling pubmed-53028042017-02-28 From east to west across the Palearctic: Phylogeography of the invasive lime leaf miner Phyllonorycter issikii (Lepidoptera: Gracillariidae) and discovery of a putative new cryptic species in East Asia Kirichenko, Natalia Triberti, Paolo Ohshima, Issei Haran, Julien Byun, Bong-Kyu Li, Houhun Augustin, Sylvie Roques, Alain Lopez-Vaamonde, Carlos PLoS One Research Article Knowing the phylogeographic structure of invasive species is important for understanding the underlying processes of invasion. The micromoth Phyllonorycter issikii, whose larvae damage leaves of lime trees Tilia spp., was only known from East Asia. In the last three decades, it has been recorded in most of Europe, Western Russia and Siberia. We used the mitochondrial cytochrome c oxidase subunit I (COI) gene region to compare the genetic variability of P. issikii populations between these different regions. Additionally, we sequenced two nuclear genes (28S rRNA and Histone 3) and run morphometric analysis of male genitalia to probe for the existence of cryptic species. The analysis of COI data of 377 insect specimens collected in 16 countries across the Palearctic revealed the presence of two different lineages: P. issikii and a putative new cryptic Phyllonorycter species distributed in the Russian Far East and Japan. In P. issikii, we identified 31 haplotypes among which 23 were detected in the invaded area (Europe) and 10 were found in its putative native range in East Asia (Russian Far East, Japan, South Korea and China), with only two common haplotypes. The high number of haplotypes found in the invaded area suggest a possible scenario of multiple introductions. One haplotype H1 was dominant (119 individuals, 67.2%), not only throughout its expanding range in Europe and Siberia but, intriguingly, also in 96% of individuals originating from Japan. We detected eight unique haplotypes of P. issikii in East Asia. Five of them were exclusively found in the Russian Far East representing 95% of individuals from that area. The putative new cryptic Phyllonorycter species showed differences from P. issikii for the three studied genes. However, both species are morphologically undistinguishable. They occur in sympatry on the same host plants in Japan (Sendai) and the Russian Far East (Primorsky krai) without evidence of admixture. Public Library of Science 2017-02-10 /pmc/articles/PMC5302804/ /pubmed/28187126 http://dx.doi.org/10.1371/journal.pone.0171104 Text en © 2017 Kirichenko et al http://creativecommons.org/licenses/by/4.0/ This is an open access article distributed under the terms of the Creative Commons Attribution License (http://creativecommons.org/licenses/by/4.0/) , which permits unrestricted use, distribution, and reproduction in any medium, provided the original author and source are credited.
spellingShingle Research Article
Kirichenko, Natalia
Triberti, Paolo
Ohshima, Issei
Haran, Julien
Byun, Bong-Kyu
Li, Houhun
Augustin, Sylvie
Roques, Alain
Lopez-Vaamonde, Carlos
From east to west across the Palearctic: Phylogeography of the invasive lime leaf miner Phyllonorycter issikii (Lepidoptera: Gracillariidae) and discovery of a putative new cryptic species in East Asia
title From east to west across the Palearctic: Phylogeography of the invasive lime leaf miner Phyllonorycter issikii (Lepidoptera: Gracillariidae) and discovery of a putative new cryptic species in East Asia
title_full From east to west across the Palearctic: Phylogeography of the invasive lime leaf miner Phyllonorycter issikii (Lepidoptera: Gracillariidae) and discovery of a putative new cryptic species in East Asia
title_fullStr From east to west across the Palearctic: Phylogeography of the invasive lime leaf miner Phyllonorycter issikii (Lepidoptera: Gracillariidae) and discovery of a putative new cryptic species in East Asia
title_full_unstemmed From east to west across the Palearctic: Phylogeography of the invasive lime leaf miner Phyllonorycter issikii (Lepidoptera: Gracillariidae) and discovery of a putative new cryptic species in East Asia
title_short From east to west across the Palearctic: Phylogeography of the invasive lime leaf miner Phyllonorycter issikii (Lepidoptera: Gracillariidae) and discovery of a putative new cryptic species in East Asia
title_sort from east to west across the palearctic: phylogeography of the invasive lime leaf miner phyllonorycter issikii (lepidoptera: gracillariidae) and discovery of a putative new cryptic species in east asia
topic Research Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5302804/
https://www.ncbi.nlm.nih.gov/pubmed/28187126
http://dx.doi.org/10.1371/journal.pone.0171104
work_keys_str_mv AT kirichenkonatalia fromeasttowestacrossthepalearcticphylogeographyoftheinvasivelimeleafminerphyllonorycterissikiilepidopteragracillariidaeanddiscoveryofaputativenewcrypticspeciesineastasia
AT tribertipaolo fromeasttowestacrossthepalearcticphylogeographyoftheinvasivelimeleafminerphyllonorycterissikiilepidopteragracillariidaeanddiscoveryofaputativenewcrypticspeciesineastasia
AT ohshimaissei fromeasttowestacrossthepalearcticphylogeographyoftheinvasivelimeleafminerphyllonorycterissikiilepidopteragracillariidaeanddiscoveryofaputativenewcrypticspeciesineastasia
AT haranjulien fromeasttowestacrossthepalearcticphylogeographyoftheinvasivelimeleafminerphyllonorycterissikiilepidopteragracillariidaeanddiscoveryofaputativenewcrypticspeciesineastasia
AT byunbongkyu fromeasttowestacrossthepalearcticphylogeographyoftheinvasivelimeleafminerphyllonorycterissikiilepidopteragracillariidaeanddiscoveryofaputativenewcrypticspeciesineastasia
AT lihouhun fromeasttowestacrossthepalearcticphylogeographyoftheinvasivelimeleafminerphyllonorycterissikiilepidopteragracillariidaeanddiscoveryofaputativenewcrypticspeciesineastasia
AT augustinsylvie fromeasttowestacrossthepalearcticphylogeographyoftheinvasivelimeleafminerphyllonorycterissikiilepidopteragracillariidaeanddiscoveryofaputativenewcrypticspeciesineastasia
AT roquesalain fromeasttowestacrossthepalearcticphylogeographyoftheinvasivelimeleafminerphyllonorycterissikiilepidopteragracillariidaeanddiscoveryofaputativenewcrypticspeciesineastasia
AT lopezvaamondecarlos fromeasttowestacrossthepalearcticphylogeographyoftheinvasivelimeleafminerphyllonorycterissikiilepidopteragracillariidaeanddiscoveryofaputativenewcrypticspeciesineastasia