Cargando…
Developing quality indicators for physician-staffed emergency medical services: a consensus process
BACKGROUND: There is increasing interest for quality measurement in health care services; pre-hospital emergency medical services (EMS) included. However, attempts of measuring the quality of physician-staffed EMS (P-EMS) are scarce. The aim of this study was to develop a set of quality indicators f...
Autores principales: | , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2017
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5311851/ https://www.ncbi.nlm.nih.gov/pubmed/28202076 http://dx.doi.org/10.1186/s13049-017-0362-4 |
_version_ | 1782508104148058112 |
---|---|
author | Haugland, Helge Rehn, Marius Klepstad, Pål Krüger, Andreas |
author_facet | Haugland, Helge Rehn, Marius Klepstad, Pål Krüger, Andreas |
author_sort | Haugland, Helge |
collection | PubMed |
description | BACKGROUND: There is increasing interest for quality measurement in health care services; pre-hospital emergency medical services (EMS) included. However, attempts of measuring the quality of physician-staffed EMS (P-EMS) are scarce. The aim of this study was to develop a set of quality indicators for international P-EMS to allow quality improvement initiatives. METHODS: A four-step modified nominal group technique process (expert panel method) was used. RESULTS: The expert panel reached consensus on 26 quality indicators for P-EMS. Fifteen quality indicators measure quality of P-EMS responses (response-specific quality indicators), whereas eleven quality indicators measure quality of P-EMS system structures (system-specific quality indicators). DISCUSSION: When measuring quality, the six quality dimensions defined by The Institute of Medicine should be appraised. We argue that this multidimensional approach to quality measurement seems particularly reasonable for services with a highly heterogenic patient population and complex operational contexts, like P-EMS. The quality indicators in this study were developed to represent a broad and comprehensive approach to quality measurement of P-EMS. CONCLUSIONS: The expert panel successfully developed a set of quality indicators for international P-EMS. The quality indicators should be prospectively tested for feasibility, validity and reliability in clinical datasets. The quality indicators should then allow for adjusted quality measurement across different P-EMS systems. ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (doi:10.1186/s13049-017-0362-4) contains supplementary material, which is available to authorized users. |
format | Online Article Text |
id | pubmed-5311851 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2017 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-53118512017-02-22 Developing quality indicators for physician-staffed emergency medical services: a consensus process Haugland, Helge Rehn, Marius Klepstad, Pål Krüger, Andreas Scand J Trauma Resusc Emerg Med Original Research BACKGROUND: There is increasing interest for quality measurement in health care services; pre-hospital emergency medical services (EMS) included. However, attempts of measuring the quality of physician-staffed EMS (P-EMS) are scarce. The aim of this study was to develop a set of quality indicators for international P-EMS to allow quality improvement initiatives. METHODS: A four-step modified nominal group technique process (expert panel method) was used. RESULTS: The expert panel reached consensus on 26 quality indicators for P-EMS. Fifteen quality indicators measure quality of P-EMS responses (response-specific quality indicators), whereas eleven quality indicators measure quality of P-EMS system structures (system-specific quality indicators). DISCUSSION: When measuring quality, the six quality dimensions defined by The Institute of Medicine should be appraised. We argue that this multidimensional approach to quality measurement seems particularly reasonable for services with a highly heterogenic patient population and complex operational contexts, like P-EMS. The quality indicators in this study were developed to represent a broad and comprehensive approach to quality measurement of P-EMS. CONCLUSIONS: The expert panel successfully developed a set of quality indicators for international P-EMS. The quality indicators should be prospectively tested for feasibility, validity and reliability in clinical datasets. The quality indicators should then allow for adjusted quality measurement across different P-EMS systems. ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (doi:10.1186/s13049-017-0362-4) contains supplementary material, which is available to authorized users. BioMed Central 2017-02-15 /pmc/articles/PMC5311851/ /pubmed/28202076 http://dx.doi.org/10.1186/s13049-017-0362-4 Text en © The Author(s). 2017 Open AccessThis article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated. |
spellingShingle | Original Research Haugland, Helge Rehn, Marius Klepstad, Pål Krüger, Andreas Developing quality indicators for physician-staffed emergency medical services: a consensus process |
title | Developing quality indicators for physician-staffed emergency medical services: a consensus process |
title_full | Developing quality indicators for physician-staffed emergency medical services: a consensus process |
title_fullStr | Developing quality indicators for physician-staffed emergency medical services: a consensus process |
title_full_unstemmed | Developing quality indicators for physician-staffed emergency medical services: a consensus process |
title_short | Developing quality indicators for physician-staffed emergency medical services: a consensus process |
title_sort | developing quality indicators for physician-staffed emergency medical services: a consensus process |
topic | Original Research |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5311851/ https://www.ncbi.nlm.nih.gov/pubmed/28202076 http://dx.doi.org/10.1186/s13049-017-0362-4 |
work_keys_str_mv | AT hauglandhelge developingqualityindicatorsforphysicianstaffedemergencymedicalservicesaconsensusprocess AT rehnmarius developingqualityindicatorsforphysicianstaffedemergencymedicalservicesaconsensusprocess AT klepstadpal developingqualityindicatorsforphysicianstaffedemergencymedicalservicesaconsensusprocess AT krugerandreas developingqualityindicatorsforphysicianstaffedemergencymedicalservicesaconsensusprocess AT developingqualityindicatorsforphysicianstaffedemergencymedicalservicesaconsensusprocess |