Cargando…
Ras-like family small GTPases genes in Nilaparvata lugens: Identification, phylogenetic analysis, gene expression and function in nymphal development
Twenty-nine cDNAs encoding Ras-like family small GTPases (RSGs) were cloned and sequenced from Nilaparvata lugens. Twenty-eight proteins are described here: 3 from Rho, 2 from Ras, 9 from Arf and 14 from Rabs. These RSGs from N.lugens have five conserved G-loop motifs and displayed a higher degree o...
Autores principales: | , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Public Library of Science
2017
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5328259/ https://www.ncbi.nlm.nih.gov/pubmed/28241066 http://dx.doi.org/10.1371/journal.pone.0172701 |
_version_ | 1782510871585488896 |
---|---|
author | Wang, Weixia Li, Kailong Wan, Pinjun Lai, Fengxiang Fu, Qiang Zhu, Tingheng |
author_facet | Wang, Weixia Li, Kailong Wan, Pinjun Lai, Fengxiang Fu, Qiang Zhu, Tingheng |
author_sort | Wang, Weixia |
collection | PubMed |
description | Twenty-nine cDNAs encoding Ras-like family small GTPases (RSGs) were cloned and sequenced from Nilaparvata lugens. Twenty-eight proteins are described here: 3 from Rho, 2 from Ras, 9 from Arf and 14 from Rabs. These RSGs from N.lugens have five conserved G-loop motifs and displayed a higher degree of sequence conservation with orthologues from insects. RT-qPCR analysis revealed NlRSGs expressed at all life stages and the highest expression was observed in hemolymph, gut or wing for most of NlRSGs. RNAi demonstrated that eighteen NlRSGs play a crucial role in nymphal development. Nymphs with silenced NlRSGs failed to molt, eclosion or development arrest. The qRT-PCR analysis verified the correlation between mortality and the down-regulation of the target genes. The expression level of nuclear receptors, Kr-h1, Hr3, FTZ-F1 and E93 involved in 20E and JH signal pathway was impacted in nymphs with silenced twelve NlRSGs individually. The expression of two halloween genes, Cyp314a1 and Cyp315a1 involved in ecdysone synthesis, decreased in nymphs with silenced NlSar1 or NlArf1. Cyp307a1 increased in nymphs with silenced NlArf6. In N.lugens with silenced NlSRβ, NlSar1 and NlRab2 at 9(th) day individually, 0.0% eclosion rate and almost 100.0% mortality was demonstrated. Further analysis showed NlSRβ could be served as a candidate target for dsRNA-based pesticides for N.lugens control. |
format | Online Article Text |
id | pubmed-5328259 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2017 |
publisher | Public Library of Science |
record_format | MEDLINE/PubMed |
spelling | pubmed-53282592017-03-09 Ras-like family small GTPases genes in Nilaparvata lugens: Identification, phylogenetic analysis, gene expression and function in nymphal development Wang, Weixia Li, Kailong Wan, Pinjun Lai, Fengxiang Fu, Qiang Zhu, Tingheng PLoS One Research Article Twenty-nine cDNAs encoding Ras-like family small GTPases (RSGs) were cloned and sequenced from Nilaparvata lugens. Twenty-eight proteins are described here: 3 from Rho, 2 from Ras, 9 from Arf and 14 from Rabs. These RSGs from N.lugens have five conserved G-loop motifs and displayed a higher degree of sequence conservation with orthologues from insects. RT-qPCR analysis revealed NlRSGs expressed at all life stages and the highest expression was observed in hemolymph, gut or wing for most of NlRSGs. RNAi demonstrated that eighteen NlRSGs play a crucial role in nymphal development. Nymphs with silenced NlRSGs failed to molt, eclosion or development arrest. The qRT-PCR analysis verified the correlation between mortality and the down-regulation of the target genes. The expression level of nuclear receptors, Kr-h1, Hr3, FTZ-F1 and E93 involved in 20E and JH signal pathway was impacted in nymphs with silenced twelve NlRSGs individually. The expression of two halloween genes, Cyp314a1 and Cyp315a1 involved in ecdysone synthesis, decreased in nymphs with silenced NlSar1 or NlArf1. Cyp307a1 increased in nymphs with silenced NlArf6. In N.lugens with silenced NlSRβ, NlSar1 and NlRab2 at 9(th) day individually, 0.0% eclosion rate and almost 100.0% mortality was demonstrated. Further analysis showed NlSRβ could be served as a candidate target for dsRNA-based pesticides for N.lugens control. Public Library of Science 2017-02-27 /pmc/articles/PMC5328259/ /pubmed/28241066 http://dx.doi.org/10.1371/journal.pone.0172701 Text en © 2017 Wang et al http://creativecommons.org/licenses/by/4.0/ This is an open access article distributed under the terms of the Creative Commons Attribution License (http://creativecommons.org/licenses/by/4.0/) , which permits unrestricted use, distribution, and reproduction in any medium, provided the original author and source are credited. |
spellingShingle | Research Article Wang, Weixia Li, Kailong Wan, Pinjun Lai, Fengxiang Fu, Qiang Zhu, Tingheng Ras-like family small GTPases genes in Nilaparvata lugens: Identification, phylogenetic analysis, gene expression and function in nymphal development |
title | Ras-like family small GTPases genes in Nilaparvata lugens: Identification, phylogenetic analysis, gene expression and function in nymphal development |
title_full | Ras-like family small GTPases genes in Nilaparvata lugens: Identification, phylogenetic analysis, gene expression and function in nymphal development |
title_fullStr | Ras-like family small GTPases genes in Nilaparvata lugens: Identification, phylogenetic analysis, gene expression and function in nymphal development |
title_full_unstemmed | Ras-like family small GTPases genes in Nilaparvata lugens: Identification, phylogenetic analysis, gene expression and function in nymphal development |
title_short | Ras-like family small GTPases genes in Nilaparvata lugens: Identification, phylogenetic analysis, gene expression and function in nymphal development |
title_sort | ras-like family small gtpases genes in nilaparvata lugens: identification, phylogenetic analysis, gene expression and function in nymphal development |
topic | Research Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5328259/ https://www.ncbi.nlm.nih.gov/pubmed/28241066 http://dx.doi.org/10.1371/journal.pone.0172701 |
work_keys_str_mv | AT wangweixia raslikefamilysmallgtpasesgenesinnilaparvatalugensidentificationphylogeneticanalysisgeneexpressionandfunctioninnymphaldevelopment AT likailong raslikefamilysmallgtpasesgenesinnilaparvatalugensidentificationphylogeneticanalysisgeneexpressionandfunctioninnymphaldevelopment AT wanpinjun raslikefamilysmallgtpasesgenesinnilaparvatalugensidentificationphylogeneticanalysisgeneexpressionandfunctioninnymphaldevelopment AT laifengxiang raslikefamilysmallgtpasesgenesinnilaparvatalugensidentificationphylogeneticanalysisgeneexpressionandfunctioninnymphaldevelopment AT fuqiang raslikefamilysmallgtpasesgenesinnilaparvatalugensidentificationphylogeneticanalysisgeneexpressionandfunctioninnymphaldevelopment AT zhutingheng raslikefamilysmallgtpasesgenesinnilaparvatalugensidentificationphylogeneticanalysisgeneexpressionandfunctioninnymphaldevelopment |