Cargando…

Association between promoter methylation of DAPK gene and HNSCC: A meta-analysis

BACKGROUND: The death-associated protein kinase (DAPK) is a tumor suppressor gene, which is a mediator of cell death of INF-γ–induced apoptosis. Aberrant methylation of DAPK promoter has been reported in patients with head and neck squamous cell carcinoma (HNSCC). However, the results of these studi...

Descripción completa

Detalles Bibliográficos
Autores principales: Cai, Fucheng, Xiao, Xiyue, Niu, Xun, Zhong, Yi
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Public Library of Science 2017
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5332095/
https://www.ncbi.nlm.nih.gov/pubmed/28249042
http://dx.doi.org/10.1371/journal.pone.0173194
_version_ 1782511490706702336
author Cai, Fucheng
Xiao, Xiyue
Niu, Xun
Zhong, Yi
author_facet Cai, Fucheng
Xiao, Xiyue
Niu, Xun
Zhong, Yi
author_sort Cai, Fucheng
collection PubMed
description BACKGROUND: The death-associated protein kinase (DAPK) is a tumor suppressor gene, which is a mediator of cell death of INF-γ–induced apoptosis. Aberrant methylation of DAPK promoter has been reported in patients with head and neck squamous cell carcinoma (HNSCC). However, the results of these studies are inconsistent. Hence, the present study aimed to evaluate the association between the promoter methylation of DAPK gene and HNSCC. METHODS: Relevant studies were systematically searched in PubMed, Web of Science, Ovid, and Embase. The association between DAPK promoter methylation and HNSCC was assessed by odds ratio (ORs) and 95% confidence intervals (CI). To evaluate the potential sources of heterogeneity, we conducted the meta-regression analysis and subgroup analysis. RESULTS: Eighteen studies were finally included in the meta-analysis. The frequency of DAPK promoter methylation in patients with HNSCC was 4.09-fold higher than the non-cancerous controls (OR = 3.96, 95%CI = 2.26–6.95). A significant association between DAPK promoter methylation and HNSCC was found among the Asian region and the Non-Asia region (Asian region, OR = 4.43, 95% CI = 2.29–8.58; Non-Asia region, OR = 3.39, 95% CI = 1.18–9.78). In the control source, the significant association between DAPK promoter methylation and HNSCC was seen among the autologous group and the heterogeneous group (autologous group, OR = 2.71, 95% CI = 1.49–4.93; heterogeneous group, OR = 9.50, 95% CI = 2.98–30.27). DAPK promoter methylation was significantly correlated with alcohol status (OR = 1.85, 95% CI = 1.07–3.21). CONCLUSION: The results of this meta-analysis suggested that aberrant methylation of DAPK promoter was associated with HNSCC.
format Online
Article
Text
id pubmed-5332095
institution National Center for Biotechnology Information
language English
publishDate 2017
publisher Public Library of Science
record_format MEDLINE/PubMed
spelling pubmed-53320952017-03-10 Association between promoter methylation of DAPK gene and HNSCC: A meta-analysis Cai, Fucheng Xiao, Xiyue Niu, Xun Zhong, Yi PLoS One Research Article BACKGROUND: The death-associated protein kinase (DAPK) is a tumor suppressor gene, which is a mediator of cell death of INF-γ–induced apoptosis. Aberrant methylation of DAPK promoter has been reported in patients with head and neck squamous cell carcinoma (HNSCC). However, the results of these studies are inconsistent. Hence, the present study aimed to evaluate the association between the promoter methylation of DAPK gene and HNSCC. METHODS: Relevant studies were systematically searched in PubMed, Web of Science, Ovid, and Embase. The association between DAPK promoter methylation and HNSCC was assessed by odds ratio (ORs) and 95% confidence intervals (CI). To evaluate the potential sources of heterogeneity, we conducted the meta-regression analysis and subgroup analysis. RESULTS: Eighteen studies were finally included in the meta-analysis. The frequency of DAPK promoter methylation in patients with HNSCC was 4.09-fold higher than the non-cancerous controls (OR = 3.96, 95%CI = 2.26–6.95). A significant association between DAPK promoter methylation and HNSCC was found among the Asian region and the Non-Asia region (Asian region, OR = 4.43, 95% CI = 2.29–8.58; Non-Asia region, OR = 3.39, 95% CI = 1.18–9.78). In the control source, the significant association between DAPK promoter methylation and HNSCC was seen among the autologous group and the heterogeneous group (autologous group, OR = 2.71, 95% CI = 1.49–4.93; heterogeneous group, OR = 9.50, 95% CI = 2.98–30.27). DAPK promoter methylation was significantly correlated with alcohol status (OR = 1.85, 95% CI = 1.07–3.21). CONCLUSION: The results of this meta-analysis suggested that aberrant methylation of DAPK promoter was associated with HNSCC. Public Library of Science 2017-03-01 /pmc/articles/PMC5332095/ /pubmed/28249042 http://dx.doi.org/10.1371/journal.pone.0173194 Text en © 2017 Cai et al http://creativecommons.org/licenses/by/4.0/ This is an open access article distributed under the terms of the Creative Commons Attribution License (http://creativecommons.org/licenses/by/4.0/) , which permits unrestricted use, distribution, and reproduction in any medium, provided the original author and source are credited.
spellingShingle Research Article
Cai, Fucheng
Xiao, Xiyue
Niu, Xun
Zhong, Yi
Association between promoter methylation of DAPK gene and HNSCC: A meta-analysis
title Association between promoter methylation of DAPK gene and HNSCC: A meta-analysis
title_full Association between promoter methylation of DAPK gene and HNSCC: A meta-analysis
title_fullStr Association between promoter methylation of DAPK gene and HNSCC: A meta-analysis
title_full_unstemmed Association between promoter methylation of DAPK gene and HNSCC: A meta-analysis
title_short Association between promoter methylation of DAPK gene and HNSCC: A meta-analysis
title_sort association between promoter methylation of dapk gene and hnscc: a meta-analysis
topic Research Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5332095/
https://www.ncbi.nlm.nih.gov/pubmed/28249042
http://dx.doi.org/10.1371/journal.pone.0173194
work_keys_str_mv AT caifucheng associationbetweenpromotermethylationofdapkgeneandhnsccametaanalysis
AT xiaoxiyue associationbetweenpromotermethylationofdapkgeneandhnsccametaanalysis
AT niuxun associationbetweenpromotermethylationofdapkgeneandhnsccametaanalysis
AT zhongyi associationbetweenpromotermethylationofdapkgeneandhnsccametaanalysis