Cargando…
Infectious keratoconjunctivitis in wild Caprinae: merging field observations and molecular analyses sheds light on factors shaping outbreak dynamics
BACKGROUND: Infectious keratoconjunctivitis (IKC) is an ocular infectious disease caused by Mycoplasma conjunctivae which affects small domestic and wild mountain ruminants. Domestic sheep maintain the pathogen but the detection of healthy carriers in wildlife has raised the question as to whether M...
Autores principales: | , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2017
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5336646/ https://www.ncbi.nlm.nih.gov/pubmed/28259139 http://dx.doi.org/10.1186/s12917-017-0972-0 |
_version_ | 1782512229912936448 |
---|---|
author | Gelormini, Giuseppina Gauthier, Dominique Vilei, Edy M. Crampe, Jean-Paul Frey, Joachim Ryser-Degiorgis, Marie-Pierre |
author_facet | Gelormini, Giuseppina Gauthier, Dominique Vilei, Edy M. Crampe, Jean-Paul Frey, Joachim Ryser-Degiorgis, Marie-Pierre |
author_sort | Gelormini, Giuseppina |
collection | PubMed |
description | BACKGROUND: Infectious keratoconjunctivitis (IKC) is an ocular infectious disease caused by Mycoplasma conjunctivae which affects small domestic and wild mountain ruminants. Domestic sheep maintain the pathogen but the detection of healthy carriers in wildlife has raised the question as to whether M. conjunctivae may also persist in the wild. Furthermore, the factors shaping the dynamics of IKC outbreaks in wildlife have remained largely unknown. The aims of this study were (1) to verify the etiological role of M. conjunctivae in IKC outbreaks recorded between 2002 and 2010 at four study sites in different regions of France (Pyrenees and Alps, samples from 159 Alpine ibex Capra ibex, Alpine chamois Rupicapra rupicapra and Pyrenean chamois Rupicapra pyrenaica); (2) to establish whether there existed any epidemiological links between the different regions through a cluster analysis of the detected strains (from 80 out of the 159 animals tested); (3) to explore selected pathogen, host and environmental factors potentially influencing the dynamics of IKC in wildlife, by joining results obtained by molecular analyses and by field observations (16,609 animal observations). All of the samples were tested for M. conjunctivae by qPCR, and cluster analysis was based on a highly variable part of the lppS gene. RESULTS: We documented infections with M. conjunctivae in epidemic and endemic situations, both in symptomatic and asymptomatic animals. The identified M. conjunctivae strains were site-specific and persisted in the local wild population for at least 6 years. In epidemic situations, peaks of cases and disease resurgence were associated with the emergence of new similar strains in a given area. Social interactions, seasonal movements and the landscape structure such as natural and anthropogenic barriers influenced the spatio-temporal spread of IKC. Adults were more affected than young animals and host susceptibility differed depending on the involved strain. CONCLUSION: Our study indicates that IKC is a multifactorial disease and that M. conjunctivae can persist in wildlife populations. The disease course in individual animals and populations is influenced by both host and mycoplasma characteristics, and the disease spread within and among populations is shaped by host behavior and landscape structure. ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (doi:10.1186/s12917-017-0972-0) contains supplementary material, which is available to authorized users. |
format | Online Article Text |
id | pubmed-5336646 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2017 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-53366462017-03-07 Infectious keratoconjunctivitis in wild Caprinae: merging field observations and molecular analyses sheds light on factors shaping outbreak dynamics Gelormini, Giuseppina Gauthier, Dominique Vilei, Edy M. Crampe, Jean-Paul Frey, Joachim Ryser-Degiorgis, Marie-Pierre BMC Vet Res Research Article BACKGROUND: Infectious keratoconjunctivitis (IKC) is an ocular infectious disease caused by Mycoplasma conjunctivae which affects small domestic and wild mountain ruminants. Domestic sheep maintain the pathogen but the detection of healthy carriers in wildlife has raised the question as to whether M. conjunctivae may also persist in the wild. Furthermore, the factors shaping the dynamics of IKC outbreaks in wildlife have remained largely unknown. The aims of this study were (1) to verify the etiological role of M. conjunctivae in IKC outbreaks recorded between 2002 and 2010 at four study sites in different regions of France (Pyrenees and Alps, samples from 159 Alpine ibex Capra ibex, Alpine chamois Rupicapra rupicapra and Pyrenean chamois Rupicapra pyrenaica); (2) to establish whether there existed any epidemiological links between the different regions through a cluster analysis of the detected strains (from 80 out of the 159 animals tested); (3) to explore selected pathogen, host and environmental factors potentially influencing the dynamics of IKC in wildlife, by joining results obtained by molecular analyses and by field observations (16,609 animal observations). All of the samples were tested for M. conjunctivae by qPCR, and cluster analysis was based on a highly variable part of the lppS gene. RESULTS: We documented infections with M. conjunctivae in epidemic and endemic situations, both in symptomatic and asymptomatic animals. The identified M. conjunctivae strains were site-specific and persisted in the local wild population for at least 6 years. In epidemic situations, peaks of cases and disease resurgence were associated with the emergence of new similar strains in a given area. Social interactions, seasonal movements and the landscape structure such as natural and anthropogenic barriers influenced the spatio-temporal spread of IKC. Adults were more affected than young animals and host susceptibility differed depending on the involved strain. CONCLUSION: Our study indicates that IKC is a multifactorial disease and that M. conjunctivae can persist in wildlife populations. The disease course in individual animals and populations is influenced by both host and mycoplasma characteristics, and the disease spread within and among populations is shaped by host behavior and landscape structure. ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (doi:10.1186/s12917-017-0972-0) contains supplementary material, which is available to authorized users. BioMed Central 2017-03-04 /pmc/articles/PMC5336646/ /pubmed/28259139 http://dx.doi.org/10.1186/s12917-017-0972-0 Text en © The Author(s). 2017 Open AccessThis article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated. |
spellingShingle | Research Article Gelormini, Giuseppina Gauthier, Dominique Vilei, Edy M. Crampe, Jean-Paul Frey, Joachim Ryser-Degiorgis, Marie-Pierre Infectious keratoconjunctivitis in wild Caprinae: merging field observations and molecular analyses sheds light on factors shaping outbreak dynamics |
title | Infectious keratoconjunctivitis in wild Caprinae: merging field observations and molecular analyses sheds light on factors shaping outbreak dynamics |
title_full | Infectious keratoconjunctivitis in wild Caprinae: merging field observations and molecular analyses sheds light on factors shaping outbreak dynamics |
title_fullStr | Infectious keratoconjunctivitis in wild Caprinae: merging field observations and molecular analyses sheds light on factors shaping outbreak dynamics |
title_full_unstemmed | Infectious keratoconjunctivitis in wild Caprinae: merging field observations and molecular analyses sheds light on factors shaping outbreak dynamics |
title_short | Infectious keratoconjunctivitis in wild Caprinae: merging field observations and molecular analyses sheds light on factors shaping outbreak dynamics |
title_sort | infectious keratoconjunctivitis in wild caprinae: merging field observations and molecular analyses sheds light on factors shaping outbreak dynamics |
topic | Research Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5336646/ https://www.ncbi.nlm.nih.gov/pubmed/28259139 http://dx.doi.org/10.1186/s12917-017-0972-0 |
work_keys_str_mv | AT gelorminigiuseppina infectiouskeratoconjunctivitisinwildcaprinaemergingfieldobservationsandmolecularanalysesshedslightonfactorsshapingoutbreakdynamics AT gauthierdominique infectiouskeratoconjunctivitisinwildcaprinaemergingfieldobservationsandmolecularanalysesshedslightonfactorsshapingoutbreakdynamics AT vileiedym infectiouskeratoconjunctivitisinwildcaprinaemergingfieldobservationsandmolecularanalysesshedslightonfactorsshapingoutbreakdynamics AT crampejeanpaul infectiouskeratoconjunctivitisinwildcaprinaemergingfieldobservationsandmolecularanalysesshedslightonfactorsshapingoutbreakdynamics AT freyjoachim infectiouskeratoconjunctivitisinwildcaprinaemergingfieldobservationsandmolecularanalysesshedslightonfactorsshapingoutbreakdynamics AT ryserdegiorgismariepierre infectiouskeratoconjunctivitisinwildcaprinaemergingfieldobservationsandmolecularanalysesshedslightonfactorsshapingoutbreakdynamics |