Cargando…

AIMD - a validated, simplified framework of interventions to promote and integrate evidence into health practices, systems, and policies

BACKGROUND: Proliferation of terms describing the science of effectively promoting and supporting the use of research evidence in healthcare policy and practice has hampered understanding and development of the field. To address this, an international Terminology Working Group developed and publishe...

Descripción completa

Detalles Bibliográficos
Autores principales: Bragge, Peter, Grimshaw, Jeremy M., Lokker, Cynthia, Colquhoun, Heather
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2017
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5336675/
https://www.ncbi.nlm.nih.gov/pubmed/28259155
http://dx.doi.org/10.1186/s12874-017-0314-8
_version_ 1782512236770623488
author Bragge, Peter
Grimshaw, Jeremy M.
Lokker, Cynthia
Colquhoun, Heather
author_facet Bragge, Peter
Grimshaw, Jeremy M.
Lokker, Cynthia
Colquhoun, Heather
author_sort Bragge, Peter
collection PubMed
description BACKGROUND: Proliferation of terms describing the science of effectively promoting and supporting the use of research evidence in healthcare policy and practice has hampered understanding and development of the field. To address this, an international Terminology Working Group developed and published a simplified framework of interventions to promote and integrate evidence into health practices, systems, and policies. This paper presents results of validation work and a second international workgroup meeting, culminating in the updated AIMD framework [Aims, Ingredients, Mechanism, Delivery]. METHODS: Framework validity was evaluated against terminology schemas (n = 51); primary studies (n = 37); and reporting guidelines (n = 10). Framework components were independently categorized as fully represented, partly represented, or absent by two researchers. Opportunities to refine the framework were systematically recorded. A meeting of the expanded international Terminology Working Group updated the framework by reviewing and deliberating upon validation findings and refinement proposals. RESULTS: There was variation in representativeness of the components across the three types of literature, in particular for the component ‘causal mechanisms’. Analysis of primary studies revealed that representativeness of this concept lowered from 92 to 68% if only explicit, rather than explicit and non-explicit references to causal mechanisms were included. All components were very well represented in reporting guidelines, however the level of description of these was lower than in other types of literature. Twelve opportunities were identified to improve the framework, 9 of which were operationalized at the meeting. The updated AIMD framework comprises four components: (1) Aims: what do you want your intervention to achieve and for whom? (2) Ingredients: what comprises the intervention? (3) Mechanisms: how do you propose the intervention will work? and (4) Delivery: how will you deliver the intervention? CONCLUSIONS: The draft simplified framework was validated with reference to a wide range of relevant literature and improvements have enhanced useability. The AIMD framework could aid in the promotion of evidence into practice, remove barriers to understanding how interventions work, enhance communication of interventions and support knowledge synthesis. Future work needs to focus on developing and testing resources and educational initiatives to optimize use of the AIMD framework in collaboration with relevant end-user groups. ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (doi:10.1186/s12874-017-0314-8) contains supplementary material, which is available to authorized users.
format Online
Article
Text
id pubmed-5336675
institution National Center for Biotechnology Information
language English
publishDate 2017
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-53366752017-03-07 AIMD - a validated, simplified framework of interventions to promote and integrate evidence into health practices, systems, and policies Bragge, Peter Grimshaw, Jeremy M. Lokker, Cynthia Colquhoun, Heather BMC Med Res Methodol Research Article BACKGROUND: Proliferation of terms describing the science of effectively promoting and supporting the use of research evidence in healthcare policy and practice has hampered understanding and development of the field. To address this, an international Terminology Working Group developed and published a simplified framework of interventions to promote and integrate evidence into health practices, systems, and policies. This paper presents results of validation work and a second international workgroup meeting, culminating in the updated AIMD framework [Aims, Ingredients, Mechanism, Delivery]. METHODS: Framework validity was evaluated against terminology schemas (n = 51); primary studies (n = 37); and reporting guidelines (n = 10). Framework components were independently categorized as fully represented, partly represented, or absent by two researchers. Opportunities to refine the framework were systematically recorded. A meeting of the expanded international Terminology Working Group updated the framework by reviewing and deliberating upon validation findings and refinement proposals. RESULTS: There was variation in representativeness of the components across the three types of literature, in particular for the component ‘causal mechanisms’. Analysis of primary studies revealed that representativeness of this concept lowered from 92 to 68% if only explicit, rather than explicit and non-explicit references to causal mechanisms were included. All components were very well represented in reporting guidelines, however the level of description of these was lower than in other types of literature. Twelve opportunities were identified to improve the framework, 9 of which were operationalized at the meeting. The updated AIMD framework comprises four components: (1) Aims: what do you want your intervention to achieve and for whom? (2) Ingredients: what comprises the intervention? (3) Mechanisms: how do you propose the intervention will work? and (4) Delivery: how will you deliver the intervention? CONCLUSIONS: The draft simplified framework was validated with reference to a wide range of relevant literature and improvements have enhanced useability. The AIMD framework could aid in the promotion of evidence into practice, remove barriers to understanding how interventions work, enhance communication of interventions and support knowledge synthesis. Future work needs to focus on developing and testing resources and educational initiatives to optimize use of the AIMD framework in collaboration with relevant end-user groups. ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (doi:10.1186/s12874-017-0314-8) contains supplementary material, which is available to authorized users. BioMed Central 2017-03-04 /pmc/articles/PMC5336675/ /pubmed/28259155 http://dx.doi.org/10.1186/s12874-017-0314-8 Text en © The Author(s). 2017 Open AccessThis article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated.
spellingShingle Research Article
Bragge, Peter
Grimshaw, Jeremy M.
Lokker, Cynthia
Colquhoun, Heather
AIMD - a validated, simplified framework of interventions to promote and integrate evidence into health practices, systems, and policies
title AIMD - a validated, simplified framework of interventions to promote and integrate evidence into health practices, systems, and policies
title_full AIMD - a validated, simplified framework of interventions to promote and integrate evidence into health practices, systems, and policies
title_fullStr AIMD - a validated, simplified framework of interventions to promote and integrate evidence into health practices, systems, and policies
title_full_unstemmed AIMD - a validated, simplified framework of interventions to promote and integrate evidence into health practices, systems, and policies
title_short AIMD - a validated, simplified framework of interventions to promote and integrate evidence into health practices, systems, and policies
title_sort aimd - a validated, simplified framework of interventions to promote and integrate evidence into health practices, systems, and policies
topic Research Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5336675/
https://www.ncbi.nlm.nih.gov/pubmed/28259155
http://dx.doi.org/10.1186/s12874-017-0314-8
work_keys_str_mv AT braggepeter aimdavalidatedsimplifiedframeworkofinterventionstopromoteandintegrateevidenceintohealthpracticessystemsandpolicies
AT grimshawjeremym aimdavalidatedsimplifiedframeworkofinterventionstopromoteandintegrateevidenceintohealthpracticessystemsandpolicies
AT lokkercynthia aimdavalidatedsimplifiedframeworkofinterventionstopromoteandintegrateevidenceintohealthpracticessystemsandpolicies
AT colquhounheather aimdavalidatedsimplifiedframeworkofinterventionstopromoteandintegrateevidenceintohealthpracticessystemsandpolicies
AT aimdavalidatedsimplifiedframeworkofinterventionstopromoteandintegrateevidenceintohealthpracticessystemsandpolicies