Difficult diagnosis of atypical kawasaki disease in an infant younger than six months: a case report

BACKGROUND: Kawasaki disease (KD) is an acute inflammatory vasculitis of unknown origin. CASE PRESENTATION: We report the case of a 5-month-old child with an atypical form of KD, characterized by undulating symptoms, who developed an aneurysm of the right coronary artery and an ectasia of the left a...

Descripción completa

Detalles Bibliográficos
Autores principales: Petrarca, L., Nenna, R., Versacci, P., Frassanito, A., Cangiano, G., Nicolai, A., Scalercio, F., Russo, L. Lo, Papoff, P., Moretti, C., Midulla, F.
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2017
Materias:
Case Report
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5341178/
https://www.ncbi.nlm.nih.gov/pubmed/28274249
http://dx.doi.org/10.1186/s13052-017-0345-0
_version_ 1782512944911745024
author Petrarca, L.
Nenna, R.
Versacci, P.
Frassanito, A.
Cangiano, G.
Nicolai, A.
Scalercio, F.
Russo, L. Lo
Papoff, P.
Moretti, C.
Midulla, F.
author_facet Petrarca, L.
Nenna, R.
Versacci, P.
Frassanito, A.
Cangiano, G.
Nicolai, A.
Scalercio, F.
Russo, L. Lo
Papoff, P.
Moretti, C.
Midulla, F.
author_sort Petrarca, L.
collection PubMed
description BACKGROUND: Kawasaki disease (KD) is an acute inflammatory vasculitis of unknown origin. CASE PRESENTATION: We report the case of a 5-month-old child with an atypical form of KD, characterized by undulating symptoms, who developed an aneurysm of the right coronary artery and an ectasia of the left anterior descending coronary artery. CONCLUSION: This case report underlines the difficulties in recognizing incomplete forms of the illness in young infants, who are at higher risk of cardiac complications.
format Online
Article
Text
id pubmed-5341178
institution National Center for Biotechnology Information
language English
publishDate 2017
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-53411782017-03-10 Difficult diagnosis of atypical kawasaki disease in an infant younger than six months: a case report Petrarca, L. Nenna, R. Versacci, P. Frassanito, A. Cangiano, G. Nicolai, A. Scalercio, F. Russo, L. Lo Papoff, P. Moretti, C. Midulla, F. Ital J Pediatr Case Report BACKGROUND: Kawasaki disease (KD) is an acute inflammatory vasculitis of unknown origin. CASE PRESENTATION: We report the case of a 5-month-old child with an atypical form of KD, characterized by undulating symptoms, who developed an aneurysm of the right coronary artery and an ectasia of the left anterior descending coronary artery. CONCLUSION: This case report underlines the difficulties in recognizing incomplete forms of the illness in young infants, who are at higher risk of cardiac complications. BioMed Central 2017-03-08 /pmc/articles/PMC5341178/ /pubmed/28274249 http://dx.doi.org/10.1186/s13052-017-0345-0 Text en © The Author(s). 2017 Open AccessThis article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated.
spellingShingle Case Report
Petrarca, L.
Nenna, R.
Versacci, P.
Frassanito, A.
Cangiano, G.
Nicolai, A.
Scalercio, F.
Russo, L. Lo
Papoff, P.
Moretti, C.
Midulla, F.
Difficult diagnosis of atypical kawasaki disease in an infant younger than six months: a case report
title Difficult diagnosis of atypical kawasaki disease in an infant younger than six months: a case report
title_full Difficult diagnosis of atypical kawasaki disease in an infant younger than six months: a case report
title_fullStr Difficult diagnosis of atypical kawasaki disease in an infant younger than six months: a case report
title_full_unstemmed Difficult diagnosis of atypical kawasaki disease in an infant younger than six months: a case report
title_short Difficult diagnosis of atypical kawasaki disease in an infant younger than six months: a case report
title_sort difficult diagnosis of atypical kawasaki disease in an infant younger than six months: a case report
topic Case Report
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5341178/
https://www.ncbi.nlm.nih.gov/pubmed/28274249
http://dx.doi.org/10.1186/s13052-017-0345-0
work_keys_str_mv AT petrarcal difficultdiagnosisofatypicalkawasakidiseaseinaninfantyoungerthansixmonthsacasereport
AT nennar difficultdiagnosisofatypicalkawasakidiseaseinaninfantyoungerthansixmonthsacasereport
AT versaccip difficultdiagnosisofatypicalkawasakidiseaseinaninfantyoungerthansixmonthsacasereport
AT frassanitoa difficultdiagnosisofatypicalkawasakidiseaseinaninfantyoungerthansixmonthsacasereport
AT cangianog difficultdiagnosisofatypicalkawasakidiseaseinaninfantyoungerthansixmonthsacasereport
AT nicolaia difficultdiagnosisofatypicalkawasakidiseaseinaninfantyoungerthansixmonthsacasereport
AT scalerciof difficultdiagnosisofatypicalkawasakidiseaseinaninfantyoungerthansixmonthsacasereport
AT russollo difficultdiagnosisofatypicalkawasakidiseaseinaninfantyoungerthansixmonthsacasereport
AT papoffp difficultdiagnosisofatypicalkawasakidiseaseinaninfantyoungerthansixmonthsacasereport
AT morettic difficultdiagnosisofatypicalkawasakidiseaseinaninfantyoungerthansixmonthsacasereport
AT midullaf difficultdiagnosisofatypicalkawasakidiseaseinaninfantyoungerthansixmonthsacasereport

Ejemplares similares