Cargando…
Myocardin-related transcription factor A (MRTF-A) activity-dependent cell adhesion is correlated to focal adhesion kinase (FAK) activity
The regulation of cell-substrate adhesion is tightly linked to the malignant phenotype of tumor cells and plays a role in their migration, invasion, and metastasis. Focal adhesions (FAs) are dynamic adhesion structures that anchor the cell to the extracellular matrix. Myocardin-related transcription...
Autores principales: | , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Impact Journals LLC
2016
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5342149/ https://www.ncbi.nlm.nih.gov/pubmed/27708220 http://dx.doi.org/10.18632/oncotarget.12350 |
_version_ | 1782513114894303232 |
---|---|
author | Kishi, Takayuki Mayanagi, Taira Iwabuchi, Sadahiro Akasaka, Toshihide Sobue, Kenji |
author_facet | Kishi, Takayuki Mayanagi, Taira Iwabuchi, Sadahiro Akasaka, Toshihide Sobue, Kenji |
author_sort | Kishi, Takayuki |
collection | PubMed |
description | The regulation of cell-substrate adhesion is tightly linked to the malignant phenotype of tumor cells and plays a role in their migration, invasion, and metastasis. Focal adhesions (FAs) are dynamic adhesion structures that anchor the cell to the extracellular matrix. Myocardin-related transcription factors (MRTFs), co-regulators of the serum response factor (SRF), regulate expression of a set of genes encoding actin cytoskeletal/FA-related proteins. Here we demonstrated that the forced expression of a constitutively active MRTF-A (CA-MRTF-A) in B16F10 melanoma cells induced the up-regulation of actin cytoskeletal and FA proteins, resulting in FA reorganization and the suppression of cell migration. Expression of CA-MRTF-A markedly increased phosphorylation of focal adhesion kinase (FAK) and paxillin, which are important components for FA dynamics. Notably, FAK activation was triggered by the clustering of up-regulated integrins. Our results revealed that the MRTF-SRF-dependent regulation of cell migration requires both the up-regulation of actin cytoskeletal/FA proteins and the integrin-mediated regulation of FA components via the FAK/Src pathway. We also demonstrated that activation of the MRTF-dependent transcription correlates FAK activation in various tumor cells. The elucidation of the correlation between MRTF and FAK activities would be an effective therapeutic target in focus of tumor cell migration. |
format | Online Article Text |
id | pubmed-5342149 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2016 |
publisher | Impact Journals LLC |
record_format | MEDLINE/PubMed |
spelling | pubmed-53421492017-03-24 Myocardin-related transcription factor A (MRTF-A) activity-dependent cell adhesion is correlated to focal adhesion kinase (FAK) activity Kishi, Takayuki Mayanagi, Taira Iwabuchi, Sadahiro Akasaka, Toshihide Sobue, Kenji Oncotarget Research Paper The regulation of cell-substrate adhesion is tightly linked to the malignant phenotype of tumor cells and plays a role in their migration, invasion, and metastasis. Focal adhesions (FAs) are dynamic adhesion structures that anchor the cell to the extracellular matrix. Myocardin-related transcription factors (MRTFs), co-regulators of the serum response factor (SRF), regulate expression of a set of genes encoding actin cytoskeletal/FA-related proteins. Here we demonstrated that the forced expression of a constitutively active MRTF-A (CA-MRTF-A) in B16F10 melanoma cells induced the up-regulation of actin cytoskeletal and FA proteins, resulting in FA reorganization and the suppression of cell migration. Expression of CA-MRTF-A markedly increased phosphorylation of focal adhesion kinase (FAK) and paxillin, which are important components for FA dynamics. Notably, FAK activation was triggered by the clustering of up-regulated integrins. Our results revealed that the MRTF-SRF-dependent regulation of cell migration requires both the up-regulation of actin cytoskeletal/FA proteins and the integrin-mediated regulation of FA components via the FAK/Src pathway. We also demonstrated that activation of the MRTF-dependent transcription correlates FAK activation in various tumor cells. The elucidation of the correlation between MRTF and FAK activities would be an effective therapeutic target in focus of tumor cell migration. Impact Journals LLC 2016-09-30 /pmc/articles/PMC5342149/ /pubmed/27708220 http://dx.doi.org/10.18632/oncotarget.12350 Text en Copyright: © 2016 Kishi et al. http://creativecommons.org/licenses/by/3.0/ This is an open-access article distributed under the terms of the Creative Commons Attribution License, which permits unrestricted use, distribution, and reproduction in any medium, provided the original author and source are credited. |
spellingShingle | Research Paper Kishi, Takayuki Mayanagi, Taira Iwabuchi, Sadahiro Akasaka, Toshihide Sobue, Kenji Myocardin-related transcription factor A (MRTF-A) activity-dependent cell adhesion is correlated to focal adhesion kinase (FAK) activity |
title | Myocardin-related transcription factor A (MRTF-A) activity-dependent cell adhesion is correlated to focal adhesion kinase (FAK) activity |
title_full | Myocardin-related transcription factor A (MRTF-A) activity-dependent cell adhesion is correlated to focal adhesion kinase (FAK) activity |
title_fullStr | Myocardin-related transcription factor A (MRTF-A) activity-dependent cell adhesion is correlated to focal adhesion kinase (FAK) activity |
title_full_unstemmed | Myocardin-related transcription factor A (MRTF-A) activity-dependent cell adhesion is correlated to focal adhesion kinase (FAK) activity |
title_short | Myocardin-related transcription factor A (MRTF-A) activity-dependent cell adhesion is correlated to focal adhesion kinase (FAK) activity |
title_sort | myocardin-related transcription factor a (mrtf-a) activity-dependent cell adhesion is correlated to focal adhesion kinase (fak) activity |
topic | Research Paper |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5342149/ https://www.ncbi.nlm.nih.gov/pubmed/27708220 http://dx.doi.org/10.18632/oncotarget.12350 |
work_keys_str_mv | AT kishitakayuki myocardinrelatedtranscriptionfactoramrtfaactivitydependentcelladhesioniscorrelatedtofocaladhesionkinasefakactivity AT mayanagitaira myocardinrelatedtranscriptionfactoramrtfaactivitydependentcelladhesioniscorrelatedtofocaladhesionkinasefakactivity AT iwabuchisadahiro myocardinrelatedtranscriptionfactoramrtfaactivitydependentcelladhesioniscorrelatedtofocaladhesionkinasefakactivity AT akasakatoshihide myocardinrelatedtranscriptionfactoramrtfaactivitydependentcelladhesioniscorrelatedtofocaladhesionkinasefakactivity AT sobuekenji myocardinrelatedtranscriptionfactoramrtfaactivitydependentcelladhesioniscorrelatedtofocaladhesionkinasefakactivity |