Cargando…

Healthcare workers’ behaviors and personal determinants associated with providing adequate sexual and reproductive healthcare services in sub-Saharan Africa: a systematic review

BACKGROUND: Healthcare workers may affect the utilization of sexual and reproductive healthcare (SRH) services, and quality of care thereof, for example by their behaviours or attitudes they hold. This can become a hindrance to accessing and utilizing SRH services, particularly by young people, and...

Descripción completa

Detalles Bibliográficos
Autores principales: Jonas, Kim, Crutzen, Rik, van den Borne, Bart, Reddy, Priscilla
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2017
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5348841/
https://www.ncbi.nlm.nih.gov/pubmed/28288565
http://dx.doi.org/10.1186/s12884-017-1268-x
_version_ 1782514335668502528
author Jonas, Kim
Crutzen, Rik
van den Borne, Bart
Reddy, Priscilla
author_facet Jonas, Kim
Crutzen, Rik
van den Borne, Bart
Reddy, Priscilla
author_sort Jonas, Kim
collection PubMed
description BACKGROUND: Healthcare workers may affect the utilization of sexual and reproductive healthcare (SRH) services, and quality of care thereof, for example by their behaviours or attitudes they hold. This can become a hindrance to accessing and utilizing SRH services, particularly by young people, and thus a better understanding of these behaviours and associated factors is needed to improve access to and utilization of SRH services. METHODS: A systematic review of literature was conducted to identify studies focusing on healthcare workers’ behaviors and personal determinants associated with providing adequate SRH services in sub-Saharan Africa (January 1990 - October 2015). Five databases were searched until 30th October 2015, using a search strategy that was adapted based on the technical requirements of each specific database. Articles were independently screened for eligibility by two researchers. Of the 125-screened full-text articles, 35 studies met all the inclusion criteria. RESULTS: Negative behaviours and attitudes of healthcare workers, as well as other personal determinants, such as poor knowledge and skills of SRH services, and related factors, like availability of essential drugs and equipment are associated with provision of inadequate SRH services. Some healthcare workers still have negative attitudes towards young people using contraceptives and are more likely to limit access to and utilization of SRH by adolescents especially. Knowledge of and implementation of specific SRH components are below optimum levels according to the WHO recommended guidelines. CONCLUSIONS: Healthcare workers’ negative behaviours and attitudes are unlikely to encourage women in general to access and utilize SRH services, but more specifically young women. Knowledge of SRH services, including basic emergency obstetric care (EmOC) is insufficient among healthcare workers in SSA. TRIAL REGISTRATION: A protocol for this systematic review was registered with PROSPERO and the registration number is: CRD42015017509. ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (doi:10.1186/s12884-017-1268-x) contains supplementary material, which is available to authorized users.
format Online
Article
Text
id pubmed-5348841
institution National Center for Biotechnology Information
language English
publishDate 2017
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-53488412017-03-14 Healthcare workers’ behaviors and personal determinants associated with providing adequate sexual and reproductive healthcare services in sub-Saharan Africa: a systematic review Jonas, Kim Crutzen, Rik van den Borne, Bart Reddy, Priscilla BMC Pregnancy Childbirth Research Article BACKGROUND: Healthcare workers may affect the utilization of sexual and reproductive healthcare (SRH) services, and quality of care thereof, for example by their behaviours or attitudes they hold. This can become a hindrance to accessing and utilizing SRH services, particularly by young people, and thus a better understanding of these behaviours and associated factors is needed to improve access to and utilization of SRH services. METHODS: A systematic review of literature was conducted to identify studies focusing on healthcare workers’ behaviors and personal determinants associated with providing adequate SRH services in sub-Saharan Africa (January 1990 - October 2015). Five databases were searched until 30th October 2015, using a search strategy that was adapted based on the technical requirements of each specific database. Articles were independently screened for eligibility by two researchers. Of the 125-screened full-text articles, 35 studies met all the inclusion criteria. RESULTS: Negative behaviours and attitudes of healthcare workers, as well as other personal determinants, such as poor knowledge and skills of SRH services, and related factors, like availability of essential drugs and equipment are associated with provision of inadequate SRH services. Some healthcare workers still have negative attitudes towards young people using contraceptives and are more likely to limit access to and utilization of SRH by adolescents especially. Knowledge of and implementation of specific SRH components are below optimum levels according to the WHO recommended guidelines. CONCLUSIONS: Healthcare workers’ negative behaviours and attitudes are unlikely to encourage women in general to access and utilize SRH services, but more specifically young women. Knowledge of SRH services, including basic emergency obstetric care (EmOC) is insufficient among healthcare workers in SSA. TRIAL REGISTRATION: A protocol for this systematic review was registered with PROSPERO and the registration number is: CRD42015017509. ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (doi:10.1186/s12884-017-1268-x) contains supplementary material, which is available to authorized users. BioMed Central 2017-03-13 /pmc/articles/PMC5348841/ /pubmed/28288565 http://dx.doi.org/10.1186/s12884-017-1268-x Text en © The Author(s). 2017 Open AccessThis article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated.
spellingShingle Research Article
Jonas, Kim
Crutzen, Rik
van den Borne, Bart
Reddy, Priscilla
Healthcare workers’ behaviors and personal determinants associated with providing adequate sexual and reproductive healthcare services in sub-Saharan Africa: a systematic review
title Healthcare workers’ behaviors and personal determinants associated with providing adequate sexual and reproductive healthcare services in sub-Saharan Africa: a systematic review
title_full Healthcare workers’ behaviors and personal determinants associated with providing adequate sexual and reproductive healthcare services in sub-Saharan Africa: a systematic review
title_fullStr Healthcare workers’ behaviors and personal determinants associated with providing adequate sexual and reproductive healthcare services in sub-Saharan Africa: a systematic review
title_full_unstemmed Healthcare workers’ behaviors and personal determinants associated with providing adequate sexual and reproductive healthcare services in sub-Saharan Africa: a systematic review
title_short Healthcare workers’ behaviors and personal determinants associated with providing adequate sexual and reproductive healthcare services in sub-Saharan Africa: a systematic review
title_sort healthcare workers’ behaviors and personal determinants associated with providing adequate sexual and reproductive healthcare services in sub-saharan africa: a systematic review
topic Research Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5348841/
https://www.ncbi.nlm.nih.gov/pubmed/28288565
http://dx.doi.org/10.1186/s12884-017-1268-x
work_keys_str_mv AT jonaskim healthcareworkersbehaviorsandpersonaldeterminantsassociatedwithprovidingadequatesexualandreproductivehealthcareservicesinsubsaharanafricaasystematicreview
AT crutzenrik healthcareworkersbehaviorsandpersonaldeterminantsassociatedwithprovidingadequatesexualandreproductivehealthcareservicesinsubsaharanafricaasystematicreview
AT vandenbornebart healthcareworkersbehaviorsandpersonaldeterminantsassociatedwithprovidingadequatesexualandreproductivehealthcareservicesinsubsaharanafricaasystematicreview
AT reddypriscilla healthcareworkersbehaviorsandpersonaldeterminantsassociatedwithprovidingadequatesexualandreproductivehealthcareservicesinsubsaharanafricaasystematicreview