Cargando…
Evaluation of the Immunomodulatory Activity of the Chicken NK-Lysin-Derived Peptide cNK-2
Chicken NK-lysin (cNK-lysin), the chicken homologue of human granulysin, is a cationic amphiphilic antimicrobial peptide (AMP) that is produced by cytotoxic T cells and natural killer cells. We previously demonstrated that cNK-lysin and cNK-2, a synthetic peptide incorporating the core α-helical reg...
Autores principales: | , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Nature Publishing Group
2017
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5362811/ https://www.ncbi.nlm.nih.gov/pubmed/28332637 http://dx.doi.org/10.1038/srep45099 |
_version_ | 1782517023656378368 |
---|---|
author | Kim, Woo H. Lillehoj, Hyun S. Min, Wongi |
author_facet | Kim, Woo H. Lillehoj, Hyun S. Min, Wongi |
author_sort | Kim, Woo H. |
collection | PubMed |
description | Chicken NK-lysin (cNK-lysin), the chicken homologue of human granulysin, is a cationic amphiphilic antimicrobial peptide (AMP) that is produced by cytotoxic T cells and natural killer cells. We previously demonstrated that cNK-lysin and cNK-2, a synthetic peptide incorporating the core α-helical region of cNK-lysin, have antimicrobial activity against apicomplexan parasites such as Eimeria spp., via membrane disruption. In addition to the antimicrobial activity of AMPs, the immunomodulatory activity of AMPs mediated by their interactions with host cells is increasingly recognized. Thus, in this study, we investigated whether cNK-lysin derived peptides modulate the immune response in the chicken macrophage cell line HD11 and in chicken primary monocytes by evaluating the induction of chemokines, anti-inflammatory properties, and activation of signalling pathways. cNK-2 induced the expression of CCL4, CCL5 and interleukin(IL)-1β in HD11 cells and CCL4 and CCL5 in primary monocytes. We also determined that cNK-2 suppresses the lipopolysaccharide-induced inflammatory response by abrogating IL-1β expression. The immunomodulatory activity of cNK-2 involves the mitogen-activated protein kinases-mediated signalling pathway, including p38, extracellular signal-regulated kinase 1/2 and c-Jun N-terminal kinases, as well as the internalization of cNK-2 into the cells. These results indicate that cNK-2 is a potential novel immunomodulating agent rather than an antimicrobial agent. |
format | Online Article Text |
id | pubmed-5362811 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2017 |
publisher | Nature Publishing Group |
record_format | MEDLINE/PubMed |
spelling | pubmed-53628112017-03-24 Evaluation of the Immunomodulatory Activity of the Chicken NK-Lysin-Derived Peptide cNK-2 Kim, Woo H. Lillehoj, Hyun S. Min, Wongi Sci Rep Article Chicken NK-lysin (cNK-lysin), the chicken homologue of human granulysin, is a cationic amphiphilic antimicrobial peptide (AMP) that is produced by cytotoxic T cells and natural killer cells. We previously demonstrated that cNK-lysin and cNK-2, a synthetic peptide incorporating the core α-helical region of cNK-lysin, have antimicrobial activity against apicomplexan parasites such as Eimeria spp., via membrane disruption. In addition to the antimicrobial activity of AMPs, the immunomodulatory activity of AMPs mediated by their interactions with host cells is increasingly recognized. Thus, in this study, we investigated whether cNK-lysin derived peptides modulate the immune response in the chicken macrophage cell line HD11 and in chicken primary monocytes by evaluating the induction of chemokines, anti-inflammatory properties, and activation of signalling pathways. cNK-2 induced the expression of CCL4, CCL5 and interleukin(IL)-1β in HD11 cells and CCL4 and CCL5 in primary monocytes. We also determined that cNK-2 suppresses the lipopolysaccharide-induced inflammatory response by abrogating IL-1β expression. The immunomodulatory activity of cNK-2 involves the mitogen-activated protein kinases-mediated signalling pathway, including p38, extracellular signal-regulated kinase 1/2 and c-Jun N-terminal kinases, as well as the internalization of cNK-2 into the cells. These results indicate that cNK-2 is a potential novel immunomodulating agent rather than an antimicrobial agent. Nature Publishing Group 2017-03-23 /pmc/articles/PMC5362811/ /pubmed/28332637 http://dx.doi.org/10.1038/srep45099 Text en Copyright © 2017, The Author(s) http://creativecommons.org/licenses/by/4.0/ This work is licensed under a Creative Commons Attribution 4.0 International License. The images or other third party material in this article are included in the article’s Creative Commons license, unless indicated otherwise in the credit line; if the material is not included under the Creative Commons license, users will need to obtain permission from the license holder to reproduce the material. To view a copy of this license, visit http://creativecommons.org/licenses/by/4.0/ |
spellingShingle | Article Kim, Woo H. Lillehoj, Hyun S. Min, Wongi Evaluation of the Immunomodulatory Activity of the Chicken NK-Lysin-Derived Peptide cNK-2 |
title | Evaluation of the Immunomodulatory Activity of the Chicken NK-Lysin-Derived Peptide cNK-2 |
title_full | Evaluation of the Immunomodulatory Activity of the Chicken NK-Lysin-Derived Peptide cNK-2 |
title_fullStr | Evaluation of the Immunomodulatory Activity of the Chicken NK-Lysin-Derived Peptide cNK-2 |
title_full_unstemmed | Evaluation of the Immunomodulatory Activity of the Chicken NK-Lysin-Derived Peptide cNK-2 |
title_short | Evaluation of the Immunomodulatory Activity of the Chicken NK-Lysin-Derived Peptide cNK-2 |
title_sort | evaluation of the immunomodulatory activity of the chicken nk-lysin-derived peptide cnk-2 |
topic | Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5362811/ https://www.ncbi.nlm.nih.gov/pubmed/28332637 http://dx.doi.org/10.1038/srep45099 |
work_keys_str_mv | AT kimwooh evaluationoftheimmunomodulatoryactivityofthechickennklysinderivedpeptidecnk2 AT lillehojhyuns evaluationoftheimmunomodulatoryactivityofthechickennklysinderivedpeptidecnk2 AT minwongi evaluationoftheimmunomodulatoryactivityofthechickennklysinderivedpeptidecnk2 |