Cargando…
Prevalence and pattern of dyslipidemia in Nepalese individuals with type 2 diabetes
BACKGROUND: Atherogenic dyslipidemia is an important modifiable risk factor for cardiovascular disease among patients of type 2 diabetes mellitus. Timely detection and characterization of this condition help clinicians estimate future risk of cardiovascular disease and take appropriate preventive me...
Autores principales: | , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2017
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5379598/ https://www.ncbi.nlm.nih.gov/pubmed/28376848 http://dx.doi.org/10.1186/s13104-017-2465-4 |
_version_ | 1782519637454356480 |
---|---|
author | Pokharel, Daya Ram Khadka, Dipendra Sigdel, Manoj Yadav, Naval Kishor Acharya, Shreedhar Kafle, Ramchandra Sapkota, Ravindra Mohan Sigdel, Tara |
author_facet | Pokharel, Daya Ram Khadka, Dipendra Sigdel, Manoj Yadav, Naval Kishor Acharya, Shreedhar Kafle, Ramchandra Sapkota, Ravindra Mohan Sigdel, Tara |
author_sort | Pokharel, Daya Ram |
collection | PubMed |
description | BACKGROUND: Atherogenic dyslipidemia is an important modifiable risk factor for cardiovascular disease among patients of type 2 diabetes mellitus. Timely detection and characterization of this condition help clinicians estimate future risk of cardiovascular disease and take appropriate preventive measures. The aim of this study was to determine the prevalence, pattern and predictors of dyslipidemia in a cohort of Nepalese patients with type 2 diabetes. RESULTS: We found mixed dyslipidemia as the most prevalent (88.1%) and isolated dyslipidemia (10.1%) as the least prevalent forms of dyslipidemia in our patients. The most prevalent form of single dyslipidemia was high LDL-C (73.8%) and combined dyslipidemia was high TG, high LDL-C and low HDL-C (44.7%). Prevalence of all single and mixed dyslipidemia was higher in patients with poor glycemic control and hypertension. The glycemic status of patients correlated with their fasting serum lipid profile. Dyslipidemia was associated mainly with male gender, poor glycemic control and hypertension. CONCLUSIONS: Atherogenic dyslipidemia is associated mainly with male gender, poor glycemic control and hypertension. It is highly prevalent in Nepalese patients with type 2 diabetes. Urgent lifestyle modification, sustained glycemic control and aggressive lipid lowering treatment plans are necessary to minimize the future risk of cardiovascular disease in this population. ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (doi:10.1186/s13104-017-2465-4) contains supplementary material, which is available to authorized users. |
format | Online Article Text |
id | pubmed-5379598 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2017 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-53795982017-04-07 Prevalence and pattern of dyslipidemia in Nepalese individuals with type 2 diabetes Pokharel, Daya Ram Khadka, Dipendra Sigdel, Manoj Yadav, Naval Kishor Acharya, Shreedhar Kafle, Ramchandra Sapkota, Ravindra Mohan Sigdel, Tara BMC Res Notes Research Article BACKGROUND: Atherogenic dyslipidemia is an important modifiable risk factor for cardiovascular disease among patients of type 2 diabetes mellitus. Timely detection and characterization of this condition help clinicians estimate future risk of cardiovascular disease and take appropriate preventive measures. The aim of this study was to determine the prevalence, pattern and predictors of dyslipidemia in a cohort of Nepalese patients with type 2 diabetes. RESULTS: We found mixed dyslipidemia as the most prevalent (88.1%) and isolated dyslipidemia (10.1%) as the least prevalent forms of dyslipidemia in our patients. The most prevalent form of single dyslipidemia was high LDL-C (73.8%) and combined dyslipidemia was high TG, high LDL-C and low HDL-C (44.7%). Prevalence of all single and mixed dyslipidemia was higher in patients with poor glycemic control and hypertension. The glycemic status of patients correlated with their fasting serum lipid profile. Dyslipidemia was associated mainly with male gender, poor glycemic control and hypertension. CONCLUSIONS: Atherogenic dyslipidemia is associated mainly with male gender, poor glycemic control and hypertension. It is highly prevalent in Nepalese patients with type 2 diabetes. Urgent lifestyle modification, sustained glycemic control and aggressive lipid lowering treatment plans are necessary to minimize the future risk of cardiovascular disease in this population. ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (doi:10.1186/s13104-017-2465-4) contains supplementary material, which is available to authorized users. BioMed Central 2017-04-04 /pmc/articles/PMC5379598/ /pubmed/28376848 http://dx.doi.org/10.1186/s13104-017-2465-4 Text en © The Author(s) 2017 Open AccessThis article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated. |
spellingShingle | Research Article Pokharel, Daya Ram Khadka, Dipendra Sigdel, Manoj Yadav, Naval Kishor Acharya, Shreedhar Kafle, Ramchandra Sapkota, Ravindra Mohan Sigdel, Tara Prevalence and pattern of dyslipidemia in Nepalese individuals with type 2 diabetes |
title | Prevalence and pattern of dyslipidemia in Nepalese individuals with type 2 diabetes |
title_full | Prevalence and pattern of dyslipidemia in Nepalese individuals with type 2 diabetes |
title_fullStr | Prevalence and pattern of dyslipidemia in Nepalese individuals with type 2 diabetes |
title_full_unstemmed | Prevalence and pattern of dyslipidemia in Nepalese individuals with type 2 diabetes |
title_short | Prevalence and pattern of dyslipidemia in Nepalese individuals with type 2 diabetes |
title_sort | prevalence and pattern of dyslipidemia in nepalese individuals with type 2 diabetes |
topic | Research Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5379598/ https://www.ncbi.nlm.nih.gov/pubmed/28376848 http://dx.doi.org/10.1186/s13104-017-2465-4 |
work_keys_str_mv | AT pokhareldayaram prevalenceandpatternofdyslipidemiainnepaleseindividualswithtype2diabetes AT khadkadipendra prevalenceandpatternofdyslipidemiainnepaleseindividualswithtype2diabetes AT sigdelmanoj prevalenceandpatternofdyslipidemiainnepaleseindividualswithtype2diabetes AT yadavnavalkishor prevalenceandpatternofdyslipidemiainnepaleseindividualswithtype2diabetes AT acharyashreedhar prevalenceandpatternofdyslipidemiainnepaleseindividualswithtype2diabetes AT kafleramchandra prevalenceandpatternofdyslipidemiainnepaleseindividualswithtype2diabetes AT sapkotaravindramohan prevalenceandpatternofdyslipidemiainnepaleseindividualswithtype2diabetes AT sigdeltara prevalenceandpatternofdyslipidemiainnepaleseindividualswithtype2diabetes |