Cargando…

Inhibition of melanogenesis by jineol from Scolopendra subspinipes mutilans via MAP-Kinase mediated MITF downregulation and the proteasomal degradation of tyrosinase

In this study, the authors investigated the anti-melanogenic effects of 3,8-dihydroxyquinoline (jineol) isolated from Scolopendra subspinipes mutilans, the mechanisms responsible for its inhibition of melanogenesis in melan-a cells, and its antioxidant efficacy. Mushroom tyrosinase activities and me...

Descripción completa

Detalles Bibliográficos
Autores principales: Alam, Md Badrul, Bajpai, Vivek K., Lee, JungIn, Zhao, Peijun, Byeon, Jung-Hee, Ra, Jeong-Sic, Majumder, Rajib, Lee, Jong Sung, Yoon, Jung-In, Rather, Irfan A., Park, Yong-Ha, Kim, Kangmin, Na, MinKyun, Lee, Sang-Han
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Nature Publishing Group 2017
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5385534/
https://www.ncbi.nlm.nih.gov/pubmed/28393917
http://dx.doi.org/10.1038/srep45858
_version_ 1782520618072145920
author Alam, Md Badrul
Bajpai, Vivek K.
Lee, JungIn
Zhao, Peijun
Byeon, Jung-Hee
Ra, Jeong-Sic
Majumder, Rajib
Lee, Jong Sung
Yoon, Jung-In
Rather, Irfan A.
Park, Yong-Ha
Kim, Kangmin
Na, MinKyun
Lee, Sang-Han
author_facet Alam, Md Badrul
Bajpai, Vivek K.
Lee, JungIn
Zhao, Peijun
Byeon, Jung-Hee
Ra, Jeong-Sic
Majumder, Rajib
Lee, Jong Sung
Yoon, Jung-In
Rather, Irfan A.
Park, Yong-Ha
Kim, Kangmin
Na, MinKyun
Lee, Sang-Han
author_sort Alam, Md Badrul
collection PubMed
description In this study, the authors investigated the anti-melanogenic effects of 3,8-dihydroxyquinoline (jineol) isolated from Scolopendra subspinipes mutilans, the mechanisms responsible for its inhibition of melanogenesis in melan-a cells, and its antioxidant efficacy. Mushroom tyrosinase activities and melanin contents were determined in melan-a cells, and the protein and mRNA levels of MITF, tyrosinase, TYRP-1, and TYRP-2 were assessed. Jineol exhibited significant, concentration-dependent antioxidant effects as determined by DPPH, ABTS, CUPRAC, and FRAP assays. Jineol significantly inhibited mushroom tyrosinase activity by functioning as an uncompetitive inhibitor, and markedly inhibited melanin production and intracellular tyrosinase activity in melan-a cells. In addition, jineol abolished the expressions of tyrosinase, TYRP-1, TYRP-2, and MITF, thereby blocking melanin production and interfering with the phosphorylations of ERK1/2 and p38. Furthermore, specific inhibitors of ERK1/2 and p38 prevented melanogenesis inhibition by jineol, and the proteasome inhibitor (MG-132) prevented jineol-induced reductions in cellular tyrosinase levels. Taken together, jineol was found to stimulate MAP-kinase (ERK1/2 and p38) phosphorylation and the proteolytic degradation pathway, which led to the degradations of MITF and tyrosinase, and to suppress the productions of melanin.
format Online
Article
Text
id pubmed-5385534
institution National Center for Biotechnology Information
language English
publishDate 2017
publisher Nature Publishing Group
record_format MEDLINE/PubMed
spelling pubmed-53855342017-04-12 Inhibition of melanogenesis by jineol from Scolopendra subspinipes mutilans via MAP-Kinase mediated MITF downregulation and the proteasomal degradation of tyrosinase Alam, Md Badrul Bajpai, Vivek K. Lee, JungIn Zhao, Peijun Byeon, Jung-Hee Ra, Jeong-Sic Majumder, Rajib Lee, Jong Sung Yoon, Jung-In Rather, Irfan A. Park, Yong-Ha Kim, Kangmin Na, MinKyun Lee, Sang-Han Sci Rep Article In this study, the authors investigated the anti-melanogenic effects of 3,8-dihydroxyquinoline (jineol) isolated from Scolopendra subspinipes mutilans, the mechanisms responsible for its inhibition of melanogenesis in melan-a cells, and its antioxidant efficacy. Mushroom tyrosinase activities and melanin contents were determined in melan-a cells, and the protein and mRNA levels of MITF, tyrosinase, TYRP-1, and TYRP-2 were assessed. Jineol exhibited significant, concentration-dependent antioxidant effects as determined by DPPH, ABTS, CUPRAC, and FRAP assays. Jineol significantly inhibited mushroom tyrosinase activity by functioning as an uncompetitive inhibitor, and markedly inhibited melanin production and intracellular tyrosinase activity in melan-a cells. In addition, jineol abolished the expressions of tyrosinase, TYRP-1, TYRP-2, and MITF, thereby blocking melanin production and interfering with the phosphorylations of ERK1/2 and p38. Furthermore, specific inhibitors of ERK1/2 and p38 prevented melanogenesis inhibition by jineol, and the proteasome inhibitor (MG-132) prevented jineol-induced reductions in cellular tyrosinase levels. Taken together, jineol was found to stimulate MAP-kinase (ERK1/2 and p38) phosphorylation and the proteolytic degradation pathway, which led to the degradations of MITF and tyrosinase, and to suppress the productions of melanin. Nature Publishing Group 2017-04-10 /pmc/articles/PMC5385534/ /pubmed/28393917 http://dx.doi.org/10.1038/srep45858 Text en Copyright © 2017, The Author(s) http://creativecommons.org/licenses/by/4.0/ This work is licensed under a Creative Commons Attribution 4.0 International License. The images or other third party material in this article are included in the article’s Creative Commons license, unless indicated otherwise in the credit line; if the material is not included under the Creative Commons license, users will need to obtain permission from the license holder to reproduce the material. To view a copy of this license, visit http://creativecommons.org/licenses/by/4.0/
spellingShingle Article
Alam, Md Badrul
Bajpai, Vivek K.
Lee, JungIn
Zhao, Peijun
Byeon, Jung-Hee
Ra, Jeong-Sic
Majumder, Rajib
Lee, Jong Sung
Yoon, Jung-In
Rather, Irfan A.
Park, Yong-Ha
Kim, Kangmin
Na, MinKyun
Lee, Sang-Han
Inhibition of melanogenesis by jineol from Scolopendra subspinipes mutilans via MAP-Kinase mediated MITF downregulation and the proteasomal degradation of tyrosinase
title Inhibition of melanogenesis by jineol from Scolopendra subspinipes mutilans via MAP-Kinase mediated MITF downregulation and the proteasomal degradation of tyrosinase
title_full Inhibition of melanogenesis by jineol from Scolopendra subspinipes mutilans via MAP-Kinase mediated MITF downregulation and the proteasomal degradation of tyrosinase
title_fullStr Inhibition of melanogenesis by jineol from Scolopendra subspinipes mutilans via MAP-Kinase mediated MITF downregulation and the proteasomal degradation of tyrosinase
title_full_unstemmed Inhibition of melanogenesis by jineol from Scolopendra subspinipes mutilans via MAP-Kinase mediated MITF downregulation and the proteasomal degradation of tyrosinase
title_short Inhibition of melanogenesis by jineol from Scolopendra subspinipes mutilans via MAP-Kinase mediated MITF downregulation and the proteasomal degradation of tyrosinase
title_sort inhibition of melanogenesis by jineol from scolopendra subspinipes mutilans via map-kinase mediated mitf downregulation and the proteasomal degradation of tyrosinase
topic Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5385534/
https://www.ncbi.nlm.nih.gov/pubmed/28393917
http://dx.doi.org/10.1038/srep45858
work_keys_str_mv AT alammdbadrul inhibitionofmelanogenesisbyjineolfromscolopendrasubspinipesmutilansviamapkinasemediatedmitfdownregulationandtheproteasomaldegradationoftyrosinase
AT bajpaivivekk inhibitionofmelanogenesisbyjineolfromscolopendrasubspinipesmutilansviamapkinasemediatedmitfdownregulationandtheproteasomaldegradationoftyrosinase
AT leejungin inhibitionofmelanogenesisbyjineolfromscolopendrasubspinipesmutilansviamapkinasemediatedmitfdownregulationandtheproteasomaldegradationoftyrosinase
AT zhaopeijun inhibitionofmelanogenesisbyjineolfromscolopendrasubspinipesmutilansviamapkinasemediatedmitfdownregulationandtheproteasomaldegradationoftyrosinase
AT byeonjunghee inhibitionofmelanogenesisbyjineolfromscolopendrasubspinipesmutilansviamapkinasemediatedmitfdownregulationandtheproteasomaldegradationoftyrosinase
AT rajeongsic inhibitionofmelanogenesisbyjineolfromscolopendrasubspinipesmutilansviamapkinasemediatedmitfdownregulationandtheproteasomaldegradationoftyrosinase
AT majumderrajib inhibitionofmelanogenesisbyjineolfromscolopendrasubspinipesmutilansviamapkinasemediatedmitfdownregulationandtheproteasomaldegradationoftyrosinase
AT leejongsung inhibitionofmelanogenesisbyjineolfromscolopendrasubspinipesmutilansviamapkinasemediatedmitfdownregulationandtheproteasomaldegradationoftyrosinase
AT yoonjungin inhibitionofmelanogenesisbyjineolfromscolopendrasubspinipesmutilansviamapkinasemediatedmitfdownregulationandtheproteasomaldegradationoftyrosinase
AT ratherirfana inhibitionofmelanogenesisbyjineolfromscolopendrasubspinipesmutilansviamapkinasemediatedmitfdownregulationandtheproteasomaldegradationoftyrosinase
AT parkyongha inhibitionofmelanogenesisbyjineolfromscolopendrasubspinipesmutilansviamapkinasemediatedmitfdownregulationandtheproteasomaldegradationoftyrosinase
AT kimkangmin inhibitionofmelanogenesisbyjineolfromscolopendrasubspinipesmutilansviamapkinasemediatedmitfdownregulationandtheproteasomaldegradationoftyrosinase
AT naminkyun inhibitionofmelanogenesisbyjineolfromscolopendrasubspinipesmutilansviamapkinasemediatedmitfdownregulationandtheproteasomaldegradationoftyrosinase
AT leesanghan inhibitionofmelanogenesisbyjineolfromscolopendrasubspinipesmutilansviamapkinasemediatedmitfdownregulationandtheproteasomaldegradationoftyrosinase