Cargando…
Inhibition of melanogenesis by jineol from Scolopendra subspinipes mutilans via MAP-Kinase mediated MITF downregulation and the proteasomal degradation of tyrosinase
In this study, the authors investigated the anti-melanogenic effects of 3,8-dihydroxyquinoline (jineol) isolated from Scolopendra subspinipes mutilans, the mechanisms responsible for its inhibition of melanogenesis in melan-a cells, and its antioxidant efficacy. Mushroom tyrosinase activities and me...
Autores principales: | , , , , , , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Nature Publishing Group
2017
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5385534/ https://www.ncbi.nlm.nih.gov/pubmed/28393917 http://dx.doi.org/10.1038/srep45858 |
_version_ | 1782520618072145920 |
---|---|
author | Alam, Md Badrul Bajpai, Vivek K. Lee, JungIn Zhao, Peijun Byeon, Jung-Hee Ra, Jeong-Sic Majumder, Rajib Lee, Jong Sung Yoon, Jung-In Rather, Irfan A. Park, Yong-Ha Kim, Kangmin Na, MinKyun Lee, Sang-Han |
author_facet | Alam, Md Badrul Bajpai, Vivek K. Lee, JungIn Zhao, Peijun Byeon, Jung-Hee Ra, Jeong-Sic Majumder, Rajib Lee, Jong Sung Yoon, Jung-In Rather, Irfan A. Park, Yong-Ha Kim, Kangmin Na, MinKyun Lee, Sang-Han |
author_sort | Alam, Md Badrul |
collection | PubMed |
description | In this study, the authors investigated the anti-melanogenic effects of 3,8-dihydroxyquinoline (jineol) isolated from Scolopendra subspinipes mutilans, the mechanisms responsible for its inhibition of melanogenesis in melan-a cells, and its antioxidant efficacy. Mushroom tyrosinase activities and melanin contents were determined in melan-a cells, and the protein and mRNA levels of MITF, tyrosinase, TYRP-1, and TYRP-2 were assessed. Jineol exhibited significant, concentration-dependent antioxidant effects as determined by DPPH, ABTS, CUPRAC, and FRAP assays. Jineol significantly inhibited mushroom tyrosinase activity by functioning as an uncompetitive inhibitor, and markedly inhibited melanin production and intracellular tyrosinase activity in melan-a cells. In addition, jineol abolished the expressions of tyrosinase, TYRP-1, TYRP-2, and MITF, thereby blocking melanin production and interfering with the phosphorylations of ERK1/2 and p38. Furthermore, specific inhibitors of ERK1/2 and p38 prevented melanogenesis inhibition by jineol, and the proteasome inhibitor (MG-132) prevented jineol-induced reductions in cellular tyrosinase levels. Taken together, jineol was found to stimulate MAP-kinase (ERK1/2 and p38) phosphorylation and the proteolytic degradation pathway, which led to the degradations of MITF and tyrosinase, and to suppress the productions of melanin. |
format | Online Article Text |
id | pubmed-5385534 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2017 |
publisher | Nature Publishing Group |
record_format | MEDLINE/PubMed |
spelling | pubmed-53855342017-04-12 Inhibition of melanogenesis by jineol from Scolopendra subspinipes mutilans via MAP-Kinase mediated MITF downregulation and the proteasomal degradation of tyrosinase Alam, Md Badrul Bajpai, Vivek K. Lee, JungIn Zhao, Peijun Byeon, Jung-Hee Ra, Jeong-Sic Majumder, Rajib Lee, Jong Sung Yoon, Jung-In Rather, Irfan A. Park, Yong-Ha Kim, Kangmin Na, MinKyun Lee, Sang-Han Sci Rep Article In this study, the authors investigated the anti-melanogenic effects of 3,8-dihydroxyquinoline (jineol) isolated from Scolopendra subspinipes mutilans, the mechanisms responsible for its inhibition of melanogenesis in melan-a cells, and its antioxidant efficacy. Mushroom tyrosinase activities and melanin contents were determined in melan-a cells, and the protein and mRNA levels of MITF, tyrosinase, TYRP-1, and TYRP-2 were assessed. Jineol exhibited significant, concentration-dependent antioxidant effects as determined by DPPH, ABTS, CUPRAC, and FRAP assays. Jineol significantly inhibited mushroom tyrosinase activity by functioning as an uncompetitive inhibitor, and markedly inhibited melanin production and intracellular tyrosinase activity in melan-a cells. In addition, jineol abolished the expressions of tyrosinase, TYRP-1, TYRP-2, and MITF, thereby blocking melanin production and interfering with the phosphorylations of ERK1/2 and p38. Furthermore, specific inhibitors of ERK1/2 and p38 prevented melanogenesis inhibition by jineol, and the proteasome inhibitor (MG-132) prevented jineol-induced reductions in cellular tyrosinase levels. Taken together, jineol was found to stimulate MAP-kinase (ERK1/2 and p38) phosphorylation and the proteolytic degradation pathway, which led to the degradations of MITF and tyrosinase, and to suppress the productions of melanin. Nature Publishing Group 2017-04-10 /pmc/articles/PMC5385534/ /pubmed/28393917 http://dx.doi.org/10.1038/srep45858 Text en Copyright © 2017, The Author(s) http://creativecommons.org/licenses/by/4.0/ This work is licensed under a Creative Commons Attribution 4.0 International License. The images or other third party material in this article are included in the article’s Creative Commons license, unless indicated otherwise in the credit line; if the material is not included under the Creative Commons license, users will need to obtain permission from the license holder to reproduce the material. To view a copy of this license, visit http://creativecommons.org/licenses/by/4.0/ |
spellingShingle | Article Alam, Md Badrul Bajpai, Vivek K. Lee, JungIn Zhao, Peijun Byeon, Jung-Hee Ra, Jeong-Sic Majumder, Rajib Lee, Jong Sung Yoon, Jung-In Rather, Irfan A. Park, Yong-Ha Kim, Kangmin Na, MinKyun Lee, Sang-Han Inhibition of melanogenesis by jineol from Scolopendra subspinipes mutilans via MAP-Kinase mediated MITF downregulation and the proteasomal degradation of tyrosinase |
title | Inhibition of melanogenesis by jineol from Scolopendra subspinipes mutilans via MAP-Kinase mediated MITF downregulation and the proteasomal degradation of tyrosinase |
title_full | Inhibition of melanogenesis by jineol from Scolopendra subspinipes mutilans via MAP-Kinase mediated MITF downregulation and the proteasomal degradation of tyrosinase |
title_fullStr | Inhibition of melanogenesis by jineol from Scolopendra subspinipes mutilans via MAP-Kinase mediated MITF downregulation and the proteasomal degradation of tyrosinase |
title_full_unstemmed | Inhibition of melanogenesis by jineol from Scolopendra subspinipes mutilans via MAP-Kinase mediated MITF downregulation and the proteasomal degradation of tyrosinase |
title_short | Inhibition of melanogenesis by jineol from Scolopendra subspinipes mutilans via MAP-Kinase mediated MITF downregulation and the proteasomal degradation of tyrosinase |
title_sort | inhibition of melanogenesis by jineol from scolopendra subspinipes mutilans via map-kinase mediated mitf downregulation and the proteasomal degradation of tyrosinase |
topic | Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5385534/ https://www.ncbi.nlm.nih.gov/pubmed/28393917 http://dx.doi.org/10.1038/srep45858 |
work_keys_str_mv | AT alammdbadrul inhibitionofmelanogenesisbyjineolfromscolopendrasubspinipesmutilansviamapkinasemediatedmitfdownregulationandtheproteasomaldegradationoftyrosinase AT bajpaivivekk inhibitionofmelanogenesisbyjineolfromscolopendrasubspinipesmutilansviamapkinasemediatedmitfdownregulationandtheproteasomaldegradationoftyrosinase AT leejungin inhibitionofmelanogenesisbyjineolfromscolopendrasubspinipesmutilansviamapkinasemediatedmitfdownregulationandtheproteasomaldegradationoftyrosinase AT zhaopeijun inhibitionofmelanogenesisbyjineolfromscolopendrasubspinipesmutilansviamapkinasemediatedmitfdownregulationandtheproteasomaldegradationoftyrosinase AT byeonjunghee inhibitionofmelanogenesisbyjineolfromscolopendrasubspinipesmutilansviamapkinasemediatedmitfdownregulationandtheproteasomaldegradationoftyrosinase AT rajeongsic inhibitionofmelanogenesisbyjineolfromscolopendrasubspinipesmutilansviamapkinasemediatedmitfdownregulationandtheproteasomaldegradationoftyrosinase AT majumderrajib inhibitionofmelanogenesisbyjineolfromscolopendrasubspinipesmutilansviamapkinasemediatedmitfdownregulationandtheproteasomaldegradationoftyrosinase AT leejongsung inhibitionofmelanogenesisbyjineolfromscolopendrasubspinipesmutilansviamapkinasemediatedmitfdownregulationandtheproteasomaldegradationoftyrosinase AT yoonjungin inhibitionofmelanogenesisbyjineolfromscolopendrasubspinipesmutilansviamapkinasemediatedmitfdownregulationandtheproteasomaldegradationoftyrosinase AT ratherirfana inhibitionofmelanogenesisbyjineolfromscolopendrasubspinipesmutilansviamapkinasemediatedmitfdownregulationandtheproteasomaldegradationoftyrosinase AT parkyongha inhibitionofmelanogenesisbyjineolfromscolopendrasubspinipesmutilansviamapkinasemediatedmitfdownregulationandtheproteasomaldegradationoftyrosinase AT kimkangmin inhibitionofmelanogenesisbyjineolfromscolopendrasubspinipesmutilansviamapkinasemediatedmitfdownregulationandtheproteasomaldegradationoftyrosinase AT naminkyun inhibitionofmelanogenesisbyjineolfromscolopendrasubspinipesmutilansviamapkinasemediatedmitfdownregulationandtheproteasomaldegradationoftyrosinase AT leesanghan inhibitionofmelanogenesisbyjineolfromscolopendrasubspinipesmutilansviamapkinasemediatedmitfdownregulationandtheproteasomaldegradationoftyrosinase |