Cargando…

Assembly of CNS Nodes of Ranvier in Myelinated Nerves Is Promoted by the Axon Cytoskeleton

Nodes of Ranvier in the axons of myelinated neurons are exemplars of the specialized cell surface domains typical of polarized cells. They are rich in voltage-gated sodium channels (Nav) and thus underpin rapid nerve impulse conduction in the vertebrate nervous system [1]. Although nodal proteins cl...

Descripción completa

Detalles Bibliográficos
Autores principales: Brivio, Veronica, Faivre-Sarrailh, Catherine, Peles, Elior, Sherman, Diane L., Brophy, Peter J.
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Cell Press 2017
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5387178/
https://www.ncbi.nlm.nih.gov/pubmed/28318976
http://dx.doi.org/10.1016/j.cub.2017.01.025
_version_ 1782520891601584128
author Brivio, Veronica
Faivre-Sarrailh, Catherine
Peles, Elior
Sherman, Diane L.
Brophy, Peter J.
author_facet Brivio, Veronica
Faivre-Sarrailh, Catherine
Peles, Elior
Sherman, Diane L.
Brophy, Peter J.
author_sort Brivio, Veronica
collection PubMed
description Nodes of Ranvier in the axons of myelinated neurons are exemplars of the specialized cell surface domains typical of polarized cells. They are rich in voltage-gated sodium channels (Nav) and thus underpin rapid nerve impulse conduction in the vertebrate nervous system [1]. Although nodal proteins cluster in response to myelination, how myelin-forming glia influence nodal assembly is poorly understood. An axoglial adhesion complex comprising glial Neurofascin155 and axonal Caspr/Contactin flanks mature nodes [2]. We have shown that assembly of this adhesion complex at the extremities of migrating oligodendroglial processes promotes process convergence along the axon during central nervous system (CNS) node assembly [3]. Here we show that anchorage of this axoglial complex to the axon cytoskeleton is essential for efficient CNS node formation. When anchorage is disrupted, both the adaptor Protein 4.1B and the cytoskeleton protein βII spectrin are mislocalized in the axon, and assembly of the node of Ranvier is significantly delayed. Nodal proteins and migrating oligodendroglial processes are no longer juxtaposed, and single detached nodal complexes replace the symmetrical heminodes found in both the CNS and peripheral nervous system (PNS) during development. We propose that axoglial adhesion complexes contribute to the formation of an interface between cytoskeletal elements enriched in Protein 4.1B and βII spectrin and those enriched in nodal ankyrinG and βIV spectrin. This clusters nascent nodal complexes at heminodes and promotes their timely coalescence to form the mature node of Ranvier. These data demonstrate a role for the axon cytoskeleton in the assembly of a critical neuronal domain, the node of Ranvier.
format Online
Article
Text
id pubmed-5387178
institution National Center for Biotechnology Information
language English
publishDate 2017
publisher Cell Press
record_format MEDLINE/PubMed
spelling pubmed-53871782017-04-17 Assembly of CNS Nodes of Ranvier in Myelinated Nerves Is Promoted by the Axon Cytoskeleton Brivio, Veronica Faivre-Sarrailh, Catherine Peles, Elior Sherman, Diane L. Brophy, Peter J. Curr Biol Report Nodes of Ranvier in the axons of myelinated neurons are exemplars of the specialized cell surface domains typical of polarized cells. They are rich in voltage-gated sodium channels (Nav) and thus underpin rapid nerve impulse conduction in the vertebrate nervous system [1]. Although nodal proteins cluster in response to myelination, how myelin-forming glia influence nodal assembly is poorly understood. An axoglial adhesion complex comprising glial Neurofascin155 and axonal Caspr/Contactin flanks mature nodes [2]. We have shown that assembly of this adhesion complex at the extremities of migrating oligodendroglial processes promotes process convergence along the axon during central nervous system (CNS) node assembly [3]. Here we show that anchorage of this axoglial complex to the axon cytoskeleton is essential for efficient CNS node formation. When anchorage is disrupted, both the adaptor Protein 4.1B and the cytoskeleton protein βII spectrin are mislocalized in the axon, and assembly of the node of Ranvier is significantly delayed. Nodal proteins and migrating oligodendroglial processes are no longer juxtaposed, and single detached nodal complexes replace the symmetrical heminodes found in both the CNS and peripheral nervous system (PNS) during development. We propose that axoglial adhesion complexes contribute to the formation of an interface between cytoskeletal elements enriched in Protein 4.1B and βII spectrin and those enriched in nodal ankyrinG and βIV spectrin. This clusters nascent nodal complexes at heminodes and promotes their timely coalescence to form the mature node of Ranvier. These data demonstrate a role for the axon cytoskeleton in the assembly of a critical neuronal domain, the node of Ranvier. Cell Press 2017-04-03 /pmc/articles/PMC5387178/ /pubmed/28318976 http://dx.doi.org/10.1016/j.cub.2017.01.025 Text en © 2017 The Author(s) http://creativecommons.org/licenses/by/4.0/ This is an open access article under the CC BY license (http://creativecommons.org/licenses/by/4.0/).
spellingShingle Report
Brivio, Veronica
Faivre-Sarrailh, Catherine
Peles, Elior
Sherman, Diane L.
Brophy, Peter J.
Assembly of CNS Nodes of Ranvier in Myelinated Nerves Is Promoted by the Axon Cytoskeleton
title Assembly of CNS Nodes of Ranvier in Myelinated Nerves Is Promoted by the Axon Cytoskeleton
title_full Assembly of CNS Nodes of Ranvier in Myelinated Nerves Is Promoted by the Axon Cytoskeleton
title_fullStr Assembly of CNS Nodes of Ranvier in Myelinated Nerves Is Promoted by the Axon Cytoskeleton
title_full_unstemmed Assembly of CNS Nodes of Ranvier in Myelinated Nerves Is Promoted by the Axon Cytoskeleton
title_short Assembly of CNS Nodes of Ranvier in Myelinated Nerves Is Promoted by the Axon Cytoskeleton
title_sort assembly of cns nodes of ranvier in myelinated nerves is promoted by the axon cytoskeleton
topic Report
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5387178/
https://www.ncbi.nlm.nih.gov/pubmed/28318976
http://dx.doi.org/10.1016/j.cub.2017.01.025
work_keys_str_mv AT brivioveronica assemblyofcnsnodesofranvierinmyelinatednervesispromotedbytheaxoncytoskeleton
AT faivresarrailhcatherine assemblyofcnsnodesofranvierinmyelinatednervesispromotedbytheaxoncytoskeleton
AT peleselior assemblyofcnsnodesofranvierinmyelinatednervesispromotedbytheaxoncytoskeleton
AT shermandianel assemblyofcnsnodesofranvierinmyelinatednervesispromotedbytheaxoncytoskeleton
AT brophypeterj assemblyofcnsnodesofranvierinmyelinatednervesispromotedbytheaxoncytoskeleton