Cargando…
Government supervision on quality of smoking-cessation counselling in midwifery practices: a qualitative exploration
BACKGROUND: The Dutch Healthcare Inspectorate supervises care providers in order to improve quality of care. Recently the inspectorate assessed and promoted the use of a guideline on smoking-cessation counselling in midwifery practices. The supervision programme consisted of an announcement of the e...
Autores principales: | , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2017
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5390412/ https://www.ncbi.nlm.nih.gov/pubmed/28407765 http://dx.doi.org/10.1186/s12913-017-2198-z |
_version_ | 1782521454940651520 |
---|---|
author | Oude Wesselink, Sandra F. Stoopendaal, Annemiek Erasmus, Vicki Smits, Déan Mackenbach, Johan P. Lingsma, Hester F. Robben, Paul B. M. |
author_facet | Oude Wesselink, Sandra F. Stoopendaal, Annemiek Erasmus, Vicki Smits, Déan Mackenbach, Johan P. Lingsma, Hester F. Robben, Paul B. M. |
author_sort | Oude Wesselink, Sandra F. |
collection | PubMed |
description | BACKGROUND: The Dutch Healthcare Inspectorate supervises care providers in order to improve quality of care. Recently the inspectorate assessed and promoted the use of a guideline on smoking-cessation counselling in midwifery practices. The supervision programme consisted of an announcement of the enforcement deadline for the guideline and site visits. The purpose of our qualitative study was to identify factors related to guideline adherence after the supervision programme, and investigate whether the programme had helped improve adherence. METHODS: We conducted semi-structured interviews with inspected and non-inspected midwives. Additionally, we studied documents and observed the inspection process. The sampled midwives all work in primary care midwifery practices providing care to pregnant smokers. The questions included the current provision of smoking-cessation counselling, support to the midwife in counselling, recent changes in provision of counselling, reasons for recent changes, knowledge about the supervision programme, and experiences with supervision by the inspectorate. RESULTS: Our results show that guideline adherence depends on several factors. Awareness and familiarity with the guideline are important, as is outcome expectancy. Additionally, motivation, guideline factors and environment factors were mentioned. Besides these previously documented factors, we found that professional collaboration also determined guideline adherence. Increased collaboration in counselling is associated with greater adherence to the guideline, such as provision of counselling and taking required training. The supervision programme helped improve stop-smoking counselling, by making midwives aware of the counselling and giving them an extrinsic motivation to provide counselling. CONCLUSION: Motivation and environmental aspects were the most important factors related to guideline adherence, and professional environment was added as significant factor. The improved guideline adherence is partly attributable to the supervision programme. ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (doi:10.1186/s12913-017-2198-z) contains supplementary material, which is available to authorized users. |
format | Online Article Text |
id | pubmed-5390412 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2017 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-53904122017-04-14 Government supervision on quality of smoking-cessation counselling in midwifery practices: a qualitative exploration Oude Wesselink, Sandra F. Stoopendaal, Annemiek Erasmus, Vicki Smits, Déan Mackenbach, Johan P. Lingsma, Hester F. Robben, Paul B. M. BMC Health Serv Res Research Article BACKGROUND: The Dutch Healthcare Inspectorate supervises care providers in order to improve quality of care. Recently the inspectorate assessed and promoted the use of a guideline on smoking-cessation counselling in midwifery practices. The supervision programme consisted of an announcement of the enforcement deadline for the guideline and site visits. The purpose of our qualitative study was to identify factors related to guideline adherence after the supervision programme, and investigate whether the programme had helped improve adherence. METHODS: We conducted semi-structured interviews with inspected and non-inspected midwives. Additionally, we studied documents and observed the inspection process. The sampled midwives all work in primary care midwifery practices providing care to pregnant smokers. The questions included the current provision of smoking-cessation counselling, support to the midwife in counselling, recent changes in provision of counselling, reasons for recent changes, knowledge about the supervision programme, and experiences with supervision by the inspectorate. RESULTS: Our results show that guideline adherence depends on several factors. Awareness and familiarity with the guideline are important, as is outcome expectancy. Additionally, motivation, guideline factors and environment factors were mentioned. Besides these previously documented factors, we found that professional collaboration also determined guideline adherence. Increased collaboration in counselling is associated with greater adherence to the guideline, such as provision of counselling and taking required training. The supervision programme helped improve stop-smoking counselling, by making midwives aware of the counselling and giving them an extrinsic motivation to provide counselling. CONCLUSION: Motivation and environmental aspects were the most important factors related to guideline adherence, and professional environment was added as significant factor. The improved guideline adherence is partly attributable to the supervision programme. ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (doi:10.1186/s12913-017-2198-z) contains supplementary material, which is available to authorized users. BioMed Central 2017-04-13 /pmc/articles/PMC5390412/ /pubmed/28407765 http://dx.doi.org/10.1186/s12913-017-2198-z Text en © The Author(s). 2017 Open AccessThis article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated. |
spellingShingle | Research Article Oude Wesselink, Sandra F. Stoopendaal, Annemiek Erasmus, Vicki Smits, Déan Mackenbach, Johan P. Lingsma, Hester F. Robben, Paul B. M. Government supervision on quality of smoking-cessation counselling in midwifery practices: a qualitative exploration |
title | Government supervision on quality of smoking-cessation counselling in midwifery practices: a qualitative exploration |
title_full | Government supervision on quality of smoking-cessation counselling in midwifery practices: a qualitative exploration |
title_fullStr | Government supervision on quality of smoking-cessation counselling in midwifery practices: a qualitative exploration |
title_full_unstemmed | Government supervision on quality of smoking-cessation counselling in midwifery practices: a qualitative exploration |
title_short | Government supervision on quality of smoking-cessation counselling in midwifery practices: a qualitative exploration |
title_sort | government supervision on quality of smoking-cessation counselling in midwifery practices: a qualitative exploration |
topic | Research Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5390412/ https://www.ncbi.nlm.nih.gov/pubmed/28407765 http://dx.doi.org/10.1186/s12913-017-2198-z |
work_keys_str_mv | AT oudewesselinksandraf governmentsupervisiononqualityofsmokingcessationcounsellinginmidwiferypracticesaqualitativeexploration AT stoopendaalannemiek governmentsupervisiononqualityofsmokingcessationcounsellinginmidwiferypracticesaqualitativeexploration AT erasmusvicki governmentsupervisiononqualityofsmokingcessationcounsellinginmidwiferypracticesaqualitativeexploration AT smitsdean governmentsupervisiononqualityofsmokingcessationcounsellinginmidwiferypracticesaqualitativeexploration AT mackenbachjohanp governmentsupervisiononqualityofsmokingcessationcounsellinginmidwiferypracticesaqualitativeexploration AT lingsmahesterf governmentsupervisiononqualityofsmokingcessationcounsellinginmidwiferypracticesaqualitativeexploration AT robbenpaulbm governmentsupervisiononqualityofsmokingcessationcounsellinginmidwiferypracticesaqualitativeexploration |