Cargando…

Government supervision on quality of smoking-cessation counselling in midwifery practices: a qualitative exploration

BACKGROUND: The Dutch Healthcare Inspectorate supervises care providers in order to improve quality of care. Recently the inspectorate assessed and promoted the use of a guideline on smoking-cessation counselling in midwifery practices. The supervision programme consisted of an announcement of the e...

Descripción completa

Detalles Bibliográficos
Autores principales: Oude Wesselink, Sandra F., Stoopendaal, Annemiek, Erasmus, Vicki, Smits, Déan, Mackenbach, Johan P., Lingsma, Hester F., Robben, Paul B. M.
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2017
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5390412/
https://www.ncbi.nlm.nih.gov/pubmed/28407765
http://dx.doi.org/10.1186/s12913-017-2198-z
_version_ 1782521454940651520
author Oude Wesselink, Sandra F.
Stoopendaal, Annemiek
Erasmus, Vicki
Smits, Déan
Mackenbach, Johan P.
Lingsma, Hester F.
Robben, Paul B. M.
author_facet Oude Wesselink, Sandra F.
Stoopendaal, Annemiek
Erasmus, Vicki
Smits, Déan
Mackenbach, Johan P.
Lingsma, Hester F.
Robben, Paul B. M.
author_sort Oude Wesselink, Sandra F.
collection PubMed
description BACKGROUND: The Dutch Healthcare Inspectorate supervises care providers in order to improve quality of care. Recently the inspectorate assessed and promoted the use of a guideline on smoking-cessation counselling in midwifery practices. The supervision programme consisted of an announcement of the enforcement deadline for the guideline and site visits. The purpose of our qualitative study was to identify factors related to guideline adherence after the supervision programme, and investigate whether the programme had helped improve adherence. METHODS: We conducted semi-structured interviews with inspected and non-inspected midwives. Additionally, we studied documents and observed the inspection process. The sampled midwives all work in primary care midwifery practices providing care to pregnant smokers. The questions included the current provision of smoking-cessation counselling, support to the midwife in counselling, recent changes in provision of counselling, reasons for recent changes, knowledge about the supervision programme, and experiences with supervision by the inspectorate. RESULTS: Our results show that guideline adherence depends on several factors. Awareness and familiarity with the guideline are important, as is outcome expectancy. Additionally, motivation, guideline factors and environment factors were mentioned. Besides these previously documented factors, we found that professional collaboration also determined guideline adherence. Increased collaboration in counselling is associated with greater adherence to the guideline, such as provision of counselling and taking required training. The supervision programme helped improve stop-smoking counselling, by making midwives aware of the counselling and giving them an extrinsic motivation to provide counselling. CONCLUSION: Motivation and environmental aspects were the most important factors related to guideline adherence, and professional environment was added as significant factor. The improved guideline adherence is partly attributable to the supervision programme. ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (doi:10.1186/s12913-017-2198-z) contains supplementary material, which is available to authorized users.
format Online
Article
Text
id pubmed-5390412
institution National Center for Biotechnology Information
language English
publishDate 2017
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-53904122017-04-14 Government supervision on quality of smoking-cessation counselling in midwifery practices: a qualitative exploration Oude Wesselink, Sandra F. Stoopendaal, Annemiek Erasmus, Vicki Smits, Déan Mackenbach, Johan P. Lingsma, Hester F. Robben, Paul B. M. BMC Health Serv Res Research Article BACKGROUND: The Dutch Healthcare Inspectorate supervises care providers in order to improve quality of care. Recently the inspectorate assessed and promoted the use of a guideline on smoking-cessation counselling in midwifery practices. The supervision programme consisted of an announcement of the enforcement deadline for the guideline and site visits. The purpose of our qualitative study was to identify factors related to guideline adherence after the supervision programme, and investigate whether the programme had helped improve adherence. METHODS: We conducted semi-structured interviews with inspected and non-inspected midwives. Additionally, we studied documents and observed the inspection process. The sampled midwives all work in primary care midwifery practices providing care to pregnant smokers. The questions included the current provision of smoking-cessation counselling, support to the midwife in counselling, recent changes in provision of counselling, reasons for recent changes, knowledge about the supervision programme, and experiences with supervision by the inspectorate. RESULTS: Our results show that guideline adherence depends on several factors. Awareness and familiarity with the guideline are important, as is outcome expectancy. Additionally, motivation, guideline factors and environment factors were mentioned. Besides these previously documented factors, we found that professional collaboration also determined guideline adherence. Increased collaboration in counselling is associated with greater adherence to the guideline, such as provision of counselling and taking required training. The supervision programme helped improve stop-smoking counselling, by making midwives aware of the counselling and giving them an extrinsic motivation to provide counselling. CONCLUSION: Motivation and environmental aspects were the most important factors related to guideline adherence, and professional environment was added as significant factor. The improved guideline adherence is partly attributable to the supervision programme. ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (doi:10.1186/s12913-017-2198-z) contains supplementary material, which is available to authorized users. BioMed Central 2017-04-13 /pmc/articles/PMC5390412/ /pubmed/28407765 http://dx.doi.org/10.1186/s12913-017-2198-z Text en © The Author(s). 2017 Open AccessThis article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated.
spellingShingle Research Article
Oude Wesselink, Sandra F.
Stoopendaal, Annemiek
Erasmus, Vicki
Smits, Déan
Mackenbach, Johan P.
Lingsma, Hester F.
Robben, Paul B. M.
Government supervision on quality of smoking-cessation counselling in midwifery practices: a qualitative exploration
title Government supervision on quality of smoking-cessation counselling in midwifery practices: a qualitative exploration
title_full Government supervision on quality of smoking-cessation counselling in midwifery practices: a qualitative exploration
title_fullStr Government supervision on quality of smoking-cessation counselling in midwifery practices: a qualitative exploration
title_full_unstemmed Government supervision on quality of smoking-cessation counselling in midwifery practices: a qualitative exploration
title_short Government supervision on quality of smoking-cessation counselling in midwifery practices: a qualitative exploration
title_sort government supervision on quality of smoking-cessation counselling in midwifery practices: a qualitative exploration
topic Research Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5390412/
https://www.ncbi.nlm.nih.gov/pubmed/28407765
http://dx.doi.org/10.1186/s12913-017-2198-z
work_keys_str_mv AT oudewesselinksandraf governmentsupervisiononqualityofsmokingcessationcounsellinginmidwiferypracticesaqualitativeexploration
AT stoopendaalannemiek governmentsupervisiononqualityofsmokingcessationcounsellinginmidwiferypracticesaqualitativeexploration
AT erasmusvicki governmentsupervisiononqualityofsmokingcessationcounsellinginmidwiferypracticesaqualitativeexploration
AT smitsdean governmentsupervisiononqualityofsmokingcessationcounsellinginmidwiferypracticesaqualitativeexploration
AT mackenbachjohanp governmentsupervisiononqualityofsmokingcessationcounsellinginmidwiferypracticesaqualitativeexploration
AT lingsmahesterf governmentsupervisiononqualityofsmokingcessationcounsellinginmidwiferypracticesaqualitativeexploration
AT robbenpaulbm governmentsupervisiononqualityofsmokingcessationcounsellinginmidwiferypracticesaqualitativeexploration