Cargando…
Acid sphingomyelinase deficiency in Western diet-fed mice protects against adipocyte hypertrophy and diet-induced liver steatosis
OBJECTIVE: Alterations in sphingolipid and ceramide metabolism have been associated with various diseases, including nonalcoholic fatty liver disease (NAFLD). Acid sphingomyelinase (ASM) converts the membrane lipid sphingomyelin to ceramide, thereby affecting membrane composition and domain formatio...
Autores principales: | , , , , , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Elsevier
2017
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5404101/ https://www.ncbi.nlm.nih.gov/pubmed/28462076 http://dx.doi.org/10.1016/j.molmet.2017.03.002 |
_version_ | 1783231525807980544 |
---|---|
author | Sydor, Svenja Sowa, Jan-Peter Megger, Dominik A. Schlattjan, Martin Jafoui, Sami Wingerter, Lena Carpinteiro, Alexander Baba, Hideo A. Bechmann, Lars P. Sitek, Barbara Gerken, Guido Gulbins, Erich Canbay, Ali |
author_facet | Sydor, Svenja Sowa, Jan-Peter Megger, Dominik A. Schlattjan, Martin Jafoui, Sami Wingerter, Lena Carpinteiro, Alexander Baba, Hideo A. Bechmann, Lars P. Sitek, Barbara Gerken, Guido Gulbins, Erich Canbay, Ali |
author_sort | Sydor, Svenja |
collection | PubMed |
description | OBJECTIVE: Alterations in sphingolipid and ceramide metabolism have been associated with various diseases, including nonalcoholic fatty liver disease (NAFLD). Acid sphingomyelinase (ASM) converts the membrane lipid sphingomyelin to ceramide, thereby affecting membrane composition and domain formation. We investigated the ways in which the Asm knockout (Smpd1(−/−)) genotype affects diet-induced NAFLD. METHODS: Smpd1(−/−) mice and wild type controls were fed either a standard or Western diet (WD) for 6 weeks. Liver and adipose tissue morphology and mRNA expression were assessed. Quantitative proteome analysis of liver tissue was performed. Expression of selected genes was quantified in adipose and liver tissue of obese NAFLD patients. RESULTS: Although Smpd1(−/−) mice exhibited basal steatosis with normal chow, no aggravation of NAFLD-type injury was observed with a Western diet. This protective effect was associated with the absence of adipocyte hypertrophy and the increased expression of genes associated with brown adipocyte differentiation. In white adipose tissue from obese patients with NAFLD, no expression of these genes was detectable. To further elucidate which pathways in liver tissue may be affected by Smpd1(−/−), we performed an unbiased proteome analysis. Protein expression in WD-fed Smpd1(−/−) mice indicated a reduction in Rictor (mTORC2) activity; this reduction was confirmed by diminished Akt phosphorylation and altered mRNA expression of Rictor target genes. CONCLUSION: These findings indicate that the protective effect of Asm deficiency on diet-induced steatosis is conferred by alterations in adipocyte morphology and lipid metabolism and by reductions in Rictor activation. |
format | Online Article Text |
id | pubmed-5404101 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2017 |
publisher | Elsevier |
record_format | MEDLINE/PubMed |
spelling | pubmed-54041012017-05-01 Acid sphingomyelinase deficiency in Western diet-fed mice protects against adipocyte hypertrophy and diet-induced liver steatosis Sydor, Svenja Sowa, Jan-Peter Megger, Dominik A. Schlattjan, Martin Jafoui, Sami Wingerter, Lena Carpinteiro, Alexander Baba, Hideo A. Bechmann, Lars P. Sitek, Barbara Gerken, Guido Gulbins, Erich Canbay, Ali Mol Metab Original Article OBJECTIVE: Alterations in sphingolipid and ceramide metabolism have been associated with various diseases, including nonalcoholic fatty liver disease (NAFLD). Acid sphingomyelinase (ASM) converts the membrane lipid sphingomyelin to ceramide, thereby affecting membrane composition and domain formation. We investigated the ways in which the Asm knockout (Smpd1(−/−)) genotype affects diet-induced NAFLD. METHODS: Smpd1(−/−) mice and wild type controls were fed either a standard or Western diet (WD) for 6 weeks. Liver and adipose tissue morphology and mRNA expression were assessed. Quantitative proteome analysis of liver tissue was performed. Expression of selected genes was quantified in adipose and liver tissue of obese NAFLD patients. RESULTS: Although Smpd1(−/−) mice exhibited basal steatosis with normal chow, no aggravation of NAFLD-type injury was observed with a Western diet. This protective effect was associated with the absence of adipocyte hypertrophy and the increased expression of genes associated with brown adipocyte differentiation. In white adipose tissue from obese patients with NAFLD, no expression of these genes was detectable. To further elucidate which pathways in liver tissue may be affected by Smpd1(−/−), we performed an unbiased proteome analysis. Protein expression in WD-fed Smpd1(−/−) mice indicated a reduction in Rictor (mTORC2) activity; this reduction was confirmed by diminished Akt phosphorylation and altered mRNA expression of Rictor target genes. CONCLUSION: These findings indicate that the protective effect of Asm deficiency on diet-induced steatosis is conferred by alterations in adipocyte morphology and lipid metabolism and by reductions in Rictor activation. Elsevier 2017-03-12 /pmc/articles/PMC5404101/ /pubmed/28462076 http://dx.doi.org/10.1016/j.molmet.2017.03.002 Text en © 2017 Published by Elsevier GmbH. http://creativecommons.org/licenses/by-nc-nd/4.0/ This is an open access article under the CC BY-NC-ND license (http://creativecommons.org/licenses/by-nc-nd/4.0/). |
spellingShingle | Original Article Sydor, Svenja Sowa, Jan-Peter Megger, Dominik A. Schlattjan, Martin Jafoui, Sami Wingerter, Lena Carpinteiro, Alexander Baba, Hideo A. Bechmann, Lars P. Sitek, Barbara Gerken, Guido Gulbins, Erich Canbay, Ali Acid sphingomyelinase deficiency in Western diet-fed mice protects against adipocyte hypertrophy and diet-induced liver steatosis |
title | Acid sphingomyelinase deficiency in Western diet-fed mice protects against adipocyte hypertrophy and diet-induced liver steatosis |
title_full | Acid sphingomyelinase deficiency in Western diet-fed mice protects against adipocyte hypertrophy and diet-induced liver steatosis |
title_fullStr | Acid sphingomyelinase deficiency in Western diet-fed mice protects against adipocyte hypertrophy and diet-induced liver steatosis |
title_full_unstemmed | Acid sphingomyelinase deficiency in Western diet-fed mice protects against adipocyte hypertrophy and diet-induced liver steatosis |
title_short | Acid sphingomyelinase deficiency in Western diet-fed mice protects against adipocyte hypertrophy and diet-induced liver steatosis |
title_sort | acid sphingomyelinase deficiency in western diet-fed mice protects against adipocyte hypertrophy and diet-induced liver steatosis |
topic | Original Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5404101/ https://www.ncbi.nlm.nih.gov/pubmed/28462076 http://dx.doi.org/10.1016/j.molmet.2017.03.002 |
work_keys_str_mv | AT sydorsvenja acidsphingomyelinasedeficiencyinwesterndietfedmiceprotectsagainstadipocytehypertrophyanddietinducedliversteatosis AT sowajanpeter acidsphingomyelinasedeficiencyinwesterndietfedmiceprotectsagainstadipocytehypertrophyanddietinducedliversteatosis AT meggerdominika acidsphingomyelinasedeficiencyinwesterndietfedmiceprotectsagainstadipocytehypertrophyanddietinducedliversteatosis AT schlattjanmartin acidsphingomyelinasedeficiencyinwesterndietfedmiceprotectsagainstadipocytehypertrophyanddietinducedliversteatosis AT jafouisami acidsphingomyelinasedeficiencyinwesterndietfedmiceprotectsagainstadipocytehypertrophyanddietinducedliversteatosis AT wingerterlena acidsphingomyelinasedeficiencyinwesterndietfedmiceprotectsagainstadipocytehypertrophyanddietinducedliversteatosis AT carpinteiroalexander acidsphingomyelinasedeficiencyinwesterndietfedmiceprotectsagainstadipocytehypertrophyanddietinducedliversteatosis AT babahideoa acidsphingomyelinasedeficiencyinwesterndietfedmiceprotectsagainstadipocytehypertrophyanddietinducedliversteatosis AT bechmannlarsp acidsphingomyelinasedeficiencyinwesterndietfedmiceprotectsagainstadipocytehypertrophyanddietinducedliversteatosis AT sitekbarbara acidsphingomyelinasedeficiencyinwesterndietfedmiceprotectsagainstadipocytehypertrophyanddietinducedliversteatosis AT gerkenguido acidsphingomyelinasedeficiencyinwesterndietfedmiceprotectsagainstadipocytehypertrophyanddietinducedliversteatosis AT gulbinserich acidsphingomyelinasedeficiencyinwesterndietfedmiceprotectsagainstadipocytehypertrophyanddietinducedliversteatosis AT canbayali acidsphingomyelinasedeficiencyinwesterndietfedmiceprotectsagainstadipocytehypertrophyanddietinducedliversteatosis |