Cargando…

TRPV4 Stimulation Induced Melatonin Secretion by Increasing Arylalkymine N-acetyltransferase (AANAT) Protein Level

Melatonin is a molecule which has gained a great deal of interest in many areas of science; its synthesis was classically known to be in the pineal gland. However, many organs synthesize melatonin, such as several ocular structures. Melatonin is known to participate in many functions apart from its...

Descripción completa

Detalles Bibliográficos
Autores principales: Alkozi, Hanan Awad, Perez de Lara, Maria J., Sánchez-Naves, Juan, Pintor, Jesús
Formato: Online Artículo Texto
Lenguaje:English
Publicado: MDPI 2017
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5412331/
https://www.ncbi.nlm.nih.gov/pubmed/28368307
http://dx.doi.org/10.3390/ijms18040746
_version_ 1783232975433891840
author Alkozi, Hanan Awad
Perez de Lara, Maria J.
Sánchez-Naves, Juan
Pintor, Jesús
author_facet Alkozi, Hanan Awad
Perez de Lara, Maria J.
Sánchez-Naves, Juan
Pintor, Jesús
author_sort Alkozi, Hanan Awad
collection PubMed
description Melatonin is a molecule which has gained a great deal of interest in many areas of science; its synthesis was classically known to be in the pineal gland. However, many organs synthesize melatonin, such as several ocular structures. Melatonin is known to participate in many functions apart from its main action regulating the circadian rhythm. It is synthesized from serotonin in two steps, with a rate-limiting step carried out by arylalkymine N-acetyltransferase (AANAT). In this report, the role of TRPV4 channel present in human ciliary body epithelial cells in AANAT production was studied. Several experiments were undertaken to verify the adequate time to reach the maximal effect by using the TRPV4 agonist GSK1016790A, together with a dose–response study. An increase of 2.4 folds in AANAT was seen after 18 h of incubation with 10 nM of GSK1016790A (p < 0.001, n = 6). This increment was verified by antagonist assays. In summary, AANAT levels and therefore melatonin synthesis change after TRPV4 channel stimulation. Using this cell model together with human ciliary body tissue it is possible to suggest that AANAT plays an important role in pathologies related to intraocular pressure.
format Online
Article
Text
id pubmed-5412331
institution National Center for Biotechnology Information
language English
publishDate 2017
publisher MDPI
record_format MEDLINE/PubMed
spelling pubmed-54123312017-05-05 TRPV4 Stimulation Induced Melatonin Secretion by Increasing Arylalkymine N-acetyltransferase (AANAT) Protein Level Alkozi, Hanan Awad Perez de Lara, Maria J. Sánchez-Naves, Juan Pintor, Jesús Int J Mol Sci Article Melatonin is a molecule which has gained a great deal of interest in many areas of science; its synthesis was classically known to be in the pineal gland. However, many organs synthesize melatonin, such as several ocular structures. Melatonin is known to participate in many functions apart from its main action regulating the circadian rhythm. It is synthesized from serotonin in two steps, with a rate-limiting step carried out by arylalkymine N-acetyltransferase (AANAT). In this report, the role of TRPV4 channel present in human ciliary body epithelial cells in AANAT production was studied. Several experiments were undertaken to verify the adequate time to reach the maximal effect by using the TRPV4 agonist GSK1016790A, together with a dose–response study. An increase of 2.4 folds in AANAT was seen after 18 h of incubation with 10 nM of GSK1016790A (p < 0.001, n = 6). This increment was verified by antagonist assays. In summary, AANAT levels and therefore melatonin synthesis change after TRPV4 channel stimulation. Using this cell model together with human ciliary body tissue it is possible to suggest that AANAT plays an important role in pathologies related to intraocular pressure. MDPI 2017-04-01 /pmc/articles/PMC5412331/ /pubmed/28368307 http://dx.doi.org/10.3390/ijms18040746 Text en © 2017 by the authors. Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (http://creativecommons.org/licenses/by/4.0/).
spellingShingle Article
Alkozi, Hanan Awad
Perez de Lara, Maria J.
Sánchez-Naves, Juan
Pintor, Jesús
TRPV4 Stimulation Induced Melatonin Secretion by Increasing Arylalkymine N-acetyltransferase (AANAT) Protein Level
title TRPV4 Stimulation Induced Melatonin Secretion by Increasing Arylalkymine N-acetyltransferase (AANAT) Protein Level
title_full TRPV4 Stimulation Induced Melatonin Secretion by Increasing Arylalkymine N-acetyltransferase (AANAT) Protein Level
title_fullStr TRPV4 Stimulation Induced Melatonin Secretion by Increasing Arylalkymine N-acetyltransferase (AANAT) Protein Level
title_full_unstemmed TRPV4 Stimulation Induced Melatonin Secretion by Increasing Arylalkymine N-acetyltransferase (AANAT) Protein Level
title_short TRPV4 Stimulation Induced Melatonin Secretion by Increasing Arylalkymine N-acetyltransferase (AANAT) Protein Level
title_sort trpv4 stimulation induced melatonin secretion by increasing arylalkymine n-acetyltransferase (aanat) protein level
topic Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5412331/
https://www.ncbi.nlm.nih.gov/pubmed/28368307
http://dx.doi.org/10.3390/ijms18040746
work_keys_str_mv AT alkozihananawad trpv4stimulationinducedmelatoninsecretionbyincreasingarylalkyminenacetyltransferaseaanatproteinlevel
AT perezdelaramariaj trpv4stimulationinducedmelatoninsecretionbyincreasingarylalkyminenacetyltransferaseaanatproteinlevel
AT sancheznavesjuan trpv4stimulationinducedmelatoninsecretionbyincreasingarylalkyminenacetyltransferaseaanatproteinlevel
AT pintorjesus trpv4stimulationinducedmelatoninsecretionbyincreasingarylalkyminenacetyltransferaseaanatproteinlevel