Cargando…

The novel lysine specific methyltransferase METTL21B affects mRNA translation through inducible and dynamic methylation of Lys-165 in human eukaryotic elongation factor 1 alpha (eEF1A)

Lysine methylation is abundant on histone proteins, representing a dynamic regulator of chromatin state and gene activity, but is also frequent on many non-histone proteins, including eukaryotic elongation factor 1 alpha (eEF1A). However, the functional significance of eEF1A methylation remains obsc...

Descripción completa

Detalles Bibliográficos
Autores principales: Małecki, Jędrzej, Aileni, Vinay Kumar, Ho, Angela Y.Y., Schwarz, Juliane, Moen, Anders, Sørensen, Vigdis, Nilges, Benedikt S., Jakobsson, Magnus E., Leidel, Sebastian A., Falnes, Pål Ø.
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Oxford University Press 2017
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5416902/
https://www.ncbi.nlm.nih.gov/pubmed/28108655
http://dx.doi.org/10.1093/nar/gkx002
_version_ 1783233841728585728
author Małecki, Jędrzej
Aileni, Vinay Kumar
Ho, Angela Y.Y.
Schwarz, Juliane
Moen, Anders
Sørensen, Vigdis
Nilges, Benedikt S.
Jakobsson, Magnus E.
Leidel, Sebastian A.
Falnes, Pål Ø.
author_facet Małecki, Jędrzej
Aileni, Vinay Kumar
Ho, Angela Y.Y.
Schwarz, Juliane
Moen, Anders
Sørensen, Vigdis
Nilges, Benedikt S.
Jakobsson, Magnus E.
Leidel, Sebastian A.
Falnes, Pål Ø.
author_sort Małecki, Jędrzej
collection PubMed
description Lysine methylation is abundant on histone proteins, representing a dynamic regulator of chromatin state and gene activity, but is also frequent on many non-histone proteins, including eukaryotic elongation factor 1 alpha (eEF1A). However, the functional significance of eEF1A methylation remains obscure and it has remained unclear whether eEF1A methylation is dynamic and subject to active regulation. We here demonstrate, using a wide range of in vitro and in vivo approaches, that the previously uncharacterized human methyltransferase METTL21B specifically targets Lys-165 in eEF1A in an aminoacyl-tRNA- and GTP-dependent manner. Interestingly, METTL21B-mediated eEF1A methylation showed strong variation across different tissues and cell lines, and was induced by altering growth conditions or by treatment with certain ER-stress-inducing drugs, concomitant with an increase in METTL21B gene expression. Moreover, genetic ablation of METTL21B function in mammalian cells caused substantial alterations in mRNA translation, as measured by ribosomal profiling. A non-canonical function for eEF1A in organization of the cellular cytoskeleton has been reported, and interestingly, METTL21B accumulated in centrosomes, in addition to the expected cytosolic localization. In summary, the present study identifies METTL21B as the enzyme responsible for methylation of eEF1A on Lys-165 and shows that this modification is dynamic, inducible and likely of regulatory importance.
format Online
Article
Text
id pubmed-5416902
institution National Center for Biotechnology Information
language English
publishDate 2017
publisher Oxford University Press
record_format MEDLINE/PubMed
spelling pubmed-54169022017-05-05 The novel lysine specific methyltransferase METTL21B affects mRNA translation through inducible and dynamic methylation of Lys-165 in human eukaryotic elongation factor 1 alpha (eEF1A) Małecki, Jędrzej Aileni, Vinay Kumar Ho, Angela Y.Y. Schwarz, Juliane Moen, Anders Sørensen, Vigdis Nilges, Benedikt S. Jakobsson, Magnus E. Leidel, Sebastian A. Falnes, Pål Ø. Nucleic Acids Res Gene regulation, Chromatin and Epigenetics Lysine methylation is abundant on histone proteins, representing a dynamic regulator of chromatin state and gene activity, but is also frequent on many non-histone proteins, including eukaryotic elongation factor 1 alpha (eEF1A). However, the functional significance of eEF1A methylation remains obscure and it has remained unclear whether eEF1A methylation is dynamic and subject to active regulation. We here demonstrate, using a wide range of in vitro and in vivo approaches, that the previously uncharacterized human methyltransferase METTL21B specifically targets Lys-165 in eEF1A in an aminoacyl-tRNA- and GTP-dependent manner. Interestingly, METTL21B-mediated eEF1A methylation showed strong variation across different tissues and cell lines, and was induced by altering growth conditions or by treatment with certain ER-stress-inducing drugs, concomitant with an increase in METTL21B gene expression. Moreover, genetic ablation of METTL21B function in mammalian cells caused substantial alterations in mRNA translation, as measured by ribosomal profiling. A non-canonical function for eEF1A in organization of the cellular cytoskeleton has been reported, and interestingly, METTL21B accumulated in centrosomes, in addition to the expected cytosolic localization. In summary, the present study identifies METTL21B as the enzyme responsible for methylation of eEF1A on Lys-165 and shows that this modification is dynamic, inducible and likely of regulatory importance. Oxford University Press 2017-05-05 2017-01-20 /pmc/articles/PMC5416902/ /pubmed/28108655 http://dx.doi.org/10.1093/nar/gkx002 Text en © The Author(s) 2017. Published by Oxford University Press on behalf of Nucleic Acids Research. http://creativecommons.org/licenses/by-nc/4.0/ This is an Open Access article distributed under the terms of the Creative Commons Attribution License (http://creativecommons.org/licenses/by-nc/4.0/), which permits non-commercial re-use, distribution, and reproduction in any medium, provided the original work is properly cited. For commercial re-use, please contact journals.permissions@oup.com
spellingShingle Gene regulation, Chromatin and Epigenetics
Małecki, Jędrzej
Aileni, Vinay Kumar
Ho, Angela Y.Y.
Schwarz, Juliane
Moen, Anders
Sørensen, Vigdis
Nilges, Benedikt S.
Jakobsson, Magnus E.
Leidel, Sebastian A.
Falnes, Pål Ø.
The novel lysine specific methyltransferase METTL21B affects mRNA translation through inducible and dynamic methylation of Lys-165 in human eukaryotic elongation factor 1 alpha (eEF1A)
title The novel lysine specific methyltransferase METTL21B affects mRNA translation through inducible and dynamic methylation of Lys-165 in human eukaryotic elongation factor 1 alpha (eEF1A)
title_full The novel lysine specific methyltransferase METTL21B affects mRNA translation through inducible and dynamic methylation of Lys-165 in human eukaryotic elongation factor 1 alpha (eEF1A)
title_fullStr The novel lysine specific methyltransferase METTL21B affects mRNA translation through inducible and dynamic methylation of Lys-165 in human eukaryotic elongation factor 1 alpha (eEF1A)
title_full_unstemmed The novel lysine specific methyltransferase METTL21B affects mRNA translation through inducible and dynamic methylation of Lys-165 in human eukaryotic elongation factor 1 alpha (eEF1A)
title_short The novel lysine specific methyltransferase METTL21B affects mRNA translation through inducible and dynamic methylation of Lys-165 in human eukaryotic elongation factor 1 alpha (eEF1A)
title_sort novel lysine specific methyltransferase mettl21b affects mrna translation through inducible and dynamic methylation of lys-165 in human eukaryotic elongation factor 1 alpha (eef1a)
topic Gene regulation, Chromatin and Epigenetics
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5416902/
https://www.ncbi.nlm.nih.gov/pubmed/28108655
http://dx.doi.org/10.1093/nar/gkx002
work_keys_str_mv AT małeckijedrzej thenovellysinespecificmethyltransferasemettl21baffectsmrnatranslationthroughinducibleanddynamicmethylationoflys165inhumaneukaryoticelongationfactor1alphaeef1a
AT ailenivinaykumar thenovellysinespecificmethyltransferasemettl21baffectsmrnatranslationthroughinducibleanddynamicmethylationoflys165inhumaneukaryoticelongationfactor1alphaeef1a
AT hoangelayy thenovellysinespecificmethyltransferasemettl21baffectsmrnatranslationthroughinducibleanddynamicmethylationoflys165inhumaneukaryoticelongationfactor1alphaeef1a
AT schwarzjuliane thenovellysinespecificmethyltransferasemettl21baffectsmrnatranslationthroughinducibleanddynamicmethylationoflys165inhumaneukaryoticelongationfactor1alphaeef1a
AT moenanders thenovellysinespecificmethyltransferasemettl21baffectsmrnatranslationthroughinducibleanddynamicmethylationoflys165inhumaneukaryoticelongationfactor1alphaeef1a
AT sørensenvigdis thenovellysinespecificmethyltransferasemettl21baffectsmrnatranslationthroughinducibleanddynamicmethylationoflys165inhumaneukaryoticelongationfactor1alphaeef1a
AT nilgesbenedikts thenovellysinespecificmethyltransferasemettl21baffectsmrnatranslationthroughinducibleanddynamicmethylationoflys165inhumaneukaryoticelongationfactor1alphaeef1a
AT jakobssonmagnuse thenovellysinespecificmethyltransferasemettl21baffectsmrnatranslationthroughinducibleanddynamicmethylationoflys165inhumaneukaryoticelongationfactor1alphaeef1a
AT leidelsebastiana thenovellysinespecificmethyltransferasemettl21baffectsmrnatranslationthroughinducibleanddynamicmethylationoflys165inhumaneukaryoticelongationfactor1alphaeef1a
AT falnespalø thenovellysinespecificmethyltransferasemettl21baffectsmrnatranslationthroughinducibleanddynamicmethylationoflys165inhumaneukaryoticelongationfactor1alphaeef1a
AT małeckijedrzej novellysinespecificmethyltransferasemettl21baffectsmrnatranslationthroughinducibleanddynamicmethylationoflys165inhumaneukaryoticelongationfactor1alphaeef1a
AT ailenivinaykumar novellysinespecificmethyltransferasemettl21baffectsmrnatranslationthroughinducibleanddynamicmethylationoflys165inhumaneukaryoticelongationfactor1alphaeef1a
AT hoangelayy novellysinespecificmethyltransferasemettl21baffectsmrnatranslationthroughinducibleanddynamicmethylationoflys165inhumaneukaryoticelongationfactor1alphaeef1a
AT schwarzjuliane novellysinespecificmethyltransferasemettl21baffectsmrnatranslationthroughinducibleanddynamicmethylationoflys165inhumaneukaryoticelongationfactor1alphaeef1a
AT moenanders novellysinespecificmethyltransferasemettl21baffectsmrnatranslationthroughinducibleanddynamicmethylationoflys165inhumaneukaryoticelongationfactor1alphaeef1a
AT sørensenvigdis novellysinespecificmethyltransferasemettl21baffectsmrnatranslationthroughinducibleanddynamicmethylationoflys165inhumaneukaryoticelongationfactor1alphaeef1a
AT nilgesbenedikts novellysinespecificmethyltransferasemettl21baffectsmrnatranslationthroughinducibleanddynamicmethylationoflys165inhumaneukaryoticelongationfactor1alphaeef1a
AT jakobssonmagnuse novellysinespecificmethyltransferasemettl21baffectsmrnatranslationthroughinducibleanddynamicmethylationoflys165inhumaneukaryoticelongationfactor1alphaeef1a
AT leidelsebastiana novellysinespecificmethyltransferasemettl21baffectsmrnatranslationthroughinducibleanddynamicmethylationoflys165inhumaneukaryoticelongationfactor1alphaeef1a
AT falnespalø novellysinespecificmethyltransferasemettl21baffectsmrnatranslationthroughinducibleanddynamicmethylationoflys165inhumaneukaryoticelongationfactor1alphaeef1a