Cargando…
The novel lysine specific methyltransferase METTL21B affects mRNA translation through inducible and dynamic methylation of Lys-165 in human eukaryotic elongation factor 1 alpha (eEF1A)
Lysine methylation is abundant on histone proteins, representing a dynamic regulator of chromatin state and gene activity, but is also frequent on many non-histone proteins, including eukaryotic elongation factor 1 alpha (eEF1A). However, the functional significance of eEF1A methylation remains obsc...
Autores principales: | , , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Oxford University Press
2017
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5416902/ https://www.ncbi.nlm.nih.gov/pubmed/28108655 http://dx.doi.org/10.1093/nar/gkx002 |
_version_ | 1783233841728585728 |
---|---|
author | Małecki, Jędrzej Aileni, Vinay Kumar Ho, Angela Y.Y. Schwarz, Juliane Moen, Anders Sørensen, Vigdis Nilges, Benedikt S. Jakobsson, Magnus E. Leidel, Sebastian A. Falnes, Pål Ø. |
author_facet | Małecki, Jędrzej Aileni, Vinay Kumar Ho, Angela Y.Y. Schwarz, Juliane Moen, Anders Sørensen, Vigdis Nilges, Benedikt S. Jakobsson, Magnus E. Leidel, Sebastian A. Falnes, Pål Ø. |
author_sort | Małecki, Jędrzej |
collection | PubMed |
description | Lysine methylation is abundant on histone proteins, representing a dynamic regulator of chromatin state and gene activity, but is also frequent on many non-histone proteins, including eukaryotic elongation factor 1 alpha (eEF1A). However, the functional significance of eEF1A methylation remains obscure and it has remained unclear whether eEF1A methylation is dynamic and subject to active regulation. We here demonstrate, using a wide range of in vitro and in vivo approaches, that the previously uncharacterized human methyltransferase METTL21B specifically targets Lys-165 in eEF1A in an aminoacyl-tRNA- and GTP-dependent manner. Interestingly, METTL21B-mediated eEF1A methylation showed strong variation across different tissues and cell lines, and was induced by altering growth conditions or by treatment with certain ER-stress-inducing drugs, concomitant with an increase in METTL21B gene expression. Moreover, genetic ablation of METTL21B function in mammalian cells caused substantial alterations in mRNA translation, as measured by ribosomal profiling. A non-canonical function for eEF1A in organization of the cellular cytoskeleton has been reported, and interestingly, METTL21B accumulated in centrosomes, in addition to the expected cytosolic localization. In summary, the present study identifies METTL21B as the enzyme responsible for methylation of eEF1A on Lys-165 and shows that this modification is dynamic, inducible and likely of regulatory importance. |
format | Online Article Text |
id | pubmed-5416902 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2017 |
publisher | Oxford University Press |
record_format | MEDLINE/PubMed |
spelling | pubmed-54169022017-05-05 The novel lysine specific methyltransferase METTL21B affects mRNA translation through inducible and dynamic methylation of Lys-165 in human eukaryotic elongation factor 1 alpha (eEF1A) Małecki, Jędrzej Aileni, Vinay Kumar Ho, Angela Y.Y. Schwarz, Juliane Moen, Anders Sørensen, Vigdis Nilges, Benedikt S. Jakobsson, Magnus E. Leidel, Sebastian A. Falnes, Pål Ø. Nucleic Acids Res Gene regulation, Chromatin and Epigenetics Lysine methylation is abundant on histone proteins, representing a dynamic regulator of chromatin state and gene activity, but is also frequent on many non-histone proteins, including eukaryotic elongation factor 1 alpha (eEF1A). However, the functional significance of eEF1A methylation remains obscure and it has remained unclear whether eEF1A methylation is dynamic and subject to active regulation. We here demonstrate, using a wide range of in vitro and in vivo approaches, that the previously uncharacterized human methyltransferase METTL21B specifically targets Lys-165 in eEF1A in an aminoacyl-tRNA- and GTP-dependent manner. Interestingly, METTL21B-mediated eEF1A methylation showed strong variation across different tissues and cell lines, and was induced by altering growth conditions or by treatment with certain ER-stress-inducing drugs, concomitant with an increase in METTL21B gene expression. Moreover, genetic ablation of METTL21B function in mammalian cells caused substantial alterations in mRNA translation, as measured by ribosomal profiling. A non-canonical function for eEF1A in organization of the cellular cytoskeleton has been reported, and interestingly, METTL21B accumulated in centrosomes, in addition to the expected cytosolic localization. In summary, the present study identifies METTL21B as the enzyme responsible for methylation of eEF1A on Lys-165 and shows that this modification is dynamic, inducible and likely of regulatory importance. Oxford University Press 2017-05-05 2017-01-20 /pmc/articles/PMC5416902/ /pubmed/28108655 http://dx.doi.org/10.1093/nar/gkx002 Text en © The Author(s) 2017. Published by Oxford University Press on behalf of Nucleic Acids Research. http://creativecommons.org/licenses/by-nc/4.0/ This is an Open Access article distributed under the terms of the Creative Commons Attribution License (http://creativecommons.org/licenses/by-nc/4.0/), which permits non-commercial re-use, distribution, and reproduction in any medium, provided the original work is properly cited. For commercial re-use, please contact journals.permissions@oup.com |
spellingShingle | Gene regulation, Chromatin and Epigenetics Małecki, Jędrzej Aileni, Vinay Kumar Ho, Angela Y.Y. Schwarz, Juliane Moen, Anders Sørensen, Vigdis Nilges, Benedikt S. Jakobsson, Magnus E. Leidel, Sebastian A. Falnes, Pål Ø. The novel lysine specific methyltransferase METTL21B affects mRNA translation through inducible and dynamic methylation of Lys-165 in human eukaryotic elongation factor 1 alpha (eEF1A) |
title | The novel lysine specific methyltransferase METTL21B affects mRNA translation through inducible and dynamic methylation of Lys-165 in human eukaryotic elongation factor 1 alpha (eEF1A) |
title_full | The novel lysine specific methyltransferase METTL21B affects mRNA translation through inducible and dynamic methylation of Lys-165 in human eukaryotic elongation factor 1 alpha (eEF1A) |
title_fullStr | The novel lysine specific methyltransferase METTL21B affects mRNA translation through inducible and dynamic methylation of Lys-165 in human eukaryotic elongation factor 1 alpha (eEF1A) |
title_full_unstemmed | The novel lysine specific methyltransferase METTL21B affects mRNA translation through inducible and dynamic methylation of Lys-165 in human eukaryotic elongation factor 1 alpha (eEF1A) |
title_short | The novel lysine specific methyltransferase METTL21B affects mRNA translation through inducible and dynamic methylation of Lys-165 in human eukaryotic elongation factor 1 alpha (eEF1A) |
title_sort | novel lysine specific methyltransferase mettl21b affects mrna translation through inducible and dynamic methylation of lys-165 in human eukaryotic elongation factor 1 alpha (eef1a) |
topic | Gene regulation, Chromatin and Epigenetics |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5416902/ https://www.ncbi.nlm.nih.gov/pubmed/28108655 http://dx.doi.org/10.1093/nar/gkx002 |
work_keys_str_mv | AT małeckijedrzej thenovellysinespecificmethyltransferasemettl21baffectsmrnatranslationthroughinducibleanddynamicmethylationoflys165inhumaneukaryoticelongationfactor1alphaeef1a AT ailenivinaykumar thenovellysinespecificmethyltransferasemettl21baffectsmrnatranslationthroughinducibleanddynamicmethylationoflys165inhumaneukaryoticelongationfactor1alphaeef1a AT hoangelayy thenovellysinespecificmethyltransferasemettl21baffectsmrnatranslationthroughinducibleanddynamicmethylationoflys165inhumaneukaryoticelongationfactor1alphaeef1a AT schwarzjuliane thenovellysinespecificmethyltransferasemettl21baffectsmrnatranslationthroughinducibleanddynamicmethylationoflys165inhumaneukaryoticelongationfactor1alphaeef1a AT moenanders thenovellysinespecificmethyltransferasemettl21baffectsmrnatranslationthroughinducibleanddynamicmethylationoflys165inhumaneukaryoticelongationfactor1alphaeef1a AT sørensenvigdis thenovellysinespecificmethyltransferasemettl21baffectsmrnatranslationthroughinducibleanddynamicmethylationoflys165inhumaneukaryoticelongationfactor1alphaeef1a AT nilgesbenedikts thenovellysinespecificmethyltransferasemettl21baffectsmrnatranslationthroughinducibleanddynamicmethylationoflys165inhumaneukaryoticelongationfactor1alphaeef1a AT jakobssonmagnuse thenovellysinespecificmethyltransferasemettl21baffectsmrnatranslationthroughinducibleanddynamicmethylationoflys165inhumaneukaryoticelongationfactor1alphaeef1a AT leidelsebastiana thenovellysinespecificmethyltransferasemettl21baffectsmrnatranslationthroughinducibleanddynamicmethylationoflys165inhumaneukaryoticelongationfactor1alphaeef1a AT falnespalø thenovellysinespecificmethyltransferasemettl21baffectsmrnatranslationthroughinducibleanddynamicmethylationoflys165inhumaneukaryoticelongationfactor1alphaeef1a AT małeckijedrzej novellysinespecificmethyltransferasemettl21baffectsmrnatranslationthroughinducibleanddynamicmethylationoflys165inhumaneukaryoticelongationfactor1alphaeef1a AT ailenivinaykumar novellysinespecificmethyltransferasemettl21baffectsmrnatranslationthroughinducibleanddynamicmethylationoflys165inhumaneukaryoticelongationfactor1alphaeef1a AT hoangelayy novellysinespecificmethyltransferasemettl21baffectsmrnatranslationthroughinducibleanddynamicmethylationoflys165inhumaneukaryoticelongationfactor1alphaeef1a AT schwarzjuliane novellysinespecificmethyltransferasemettl21baffectsmrnatranslationthroughinducibleanddynamicmethylationoflys165inhumaneukaryoticelongationfactor1alphaeef1a AT moenanders novellysinespecificmethyltransferasemettl21baffectsmrnatranslationthroughinducibleanddynamicmethylationoflys165inhumaneukaryoticelongationfactor1alphaeef1a AT sørensenvigdis novellysinespecificmethyltransferasemettl21baffectsmrnatranslationthroughinducibleanddynamicmethylationoflys165inhumaneukaryoticelongationfactor1alphaeef1a AT nilgesbenedikts novellysinespecificmethyltransferasemettl21baffectsmrnatranslationthroughinducibleanddynamicmethylationoflys165inhumaneukaryoticelongationfactor1alphaeef1a AT jakobssonmagnuse novellysinespecificmethyltransferasemettl21baffectsmrnatranslationthroughinducibleanddynamicmethylationoflys165inhumaneukaryoticelongationfactor1alphaeef1a AT leidelsebastiana novellysinespecificmethyltransferasemettl21baffectsmrnatranslationthroughinducibleanddynamicmethylationoflys165inhumaneukaryoticelongationfactor1alphaeef1a AT falnespalø novellysinespecificmethyltransferasemettl21baffectsmrnatranslationthroughinducibleanddynamicmethylationoflys165inhumaneukaryoticelongationfactor1alphaeef1a |