Cargando…
Nutritional deficiencies in homeless persons with problematic drinking: a systematic review
BACKGROUND: A significant proportion of homeless people drink alcohol excessively and this can lead to malnutrition and consequent medical problems. The aim of this review was to assess the evidence on the range of nutritional deficiencies in the homeless problem-drinking populations. METHODS: We co...
Autores principales: | , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2017
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5418701/ https://www.ncbi.nlm.nih.gov/pubmed/28476156 http://dx.doi.org/10.1186/s12939-017-0564-4 |
_version_ | 1783234092608782336 |
---|---|
author | Ijaz, Sharea Jackson, Joni Thorley, Helen Porter, Katie Fleming, Clare Richards, Alison Bonner, Adrian Savović, Jelena |
author_facet | Ijaz, Sharea Jackson, Joni Thorley, Helen Porter, Katie Fleming, Clare Richards, Alison Bonner, Adrian Savović, Jelena |
author_sort | Ijaz, Sharea |
collection | PubMed |
description | BACKGROUND: A significant proportion of homeless people drink alcohol excessively and this can lead to malnutrition and consequent medical problems. The aim of this review was to assess the evidence on the range of nutritional deficiencies in the homeless problem-drinking populations. METHODS: We conducted a comprehensive search of nine scientific literature databases and 13 grey literature sources. We included studies of any design that included homeless population with problem-drinking and reported measures of nutritional deficiencies in urine or blood. Study selection and data extraction was done by one reviewer and checked by another. Data on malnutrition profile were summarized narratively. RESULTS: We found nine studies reporting nutritional deficiencies in homeless populations with problem-drinking. The oldest study was from the 1950s and the most recent from 2013. The following nutrients were reported across studies: vitamins B1, B2, B6, B9, B12, C, A, and E; haemoglobin; and albumin. The most common deficiencies reported were of vitamin B1 (prevalence of deficiency was 0, 2, 6, 45, and 51% in five studies) and vitamin C (29, 84, and 95% in three studies). None of the studies were assessed to be at a low risk of bias. CONCLUSIONS: The limited, low quality and relatively old evidence suggests that homeless people who drink heavily may be deficient in vitamin C, thiamine, and other nutrients. New, well conducted studies are needed in order to optimally inform public health interventions aimed at improving deficiencies in this population. TRIAL REGISTRATION: PROSPERO CRD42015024247 ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (doi:10.1186/s12939-017-0564-4) contains supplementary material, which is available to authorized users. |
format | Online Article Text |
id | pubmed-5418701 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2017 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-54187012017-05-08 Nutritional deficiencies in homeless persons with problematic drinking: a systematic review Ijaz, Sharea Jackson, Joni Thorley, Helen Porter, Katie Fleming, Clare Richards, Alison Bonner, Adrian Savović, Jelena Int J Equity Health Systematic Review BACKGROUND: A significant proportion of homeless people drink alcohol excessively and this can lead to malnutrition and consequent medical problems. The aim of this review was to assess the evidence on the range of nutritional deficiencies in the homeless problem-drinking populations. METHODS: We conducted a comprehensive search of nine scientific literature databases and 13 grey literature sources. We included studies of any design that included homeless population with problem-drinking and reported measures of nutritional deficiencies in urine or blood. Study selection and data extraction was done by one reviewer and checked by another. Data on malnutrition profile were summarized narratively. RESULTS: We found nine studies reporting nutritional deficiencies in homeless populations with problem-drinking. The oldest study was from the 1950s and the most recent from 2013. The following nutrients were reported across studies: vitamins B1, B2, B6, B9, B12, C, A, and E; haemoglobin; and albumin. The most common deficiencies reported were of vitamin B1 (prevalence of deficiency was 0, 2, 6, 45, and 51% in five studies) and vitamin C (29, 84, and 95% in three studies). None of the studies were assessed to be at a low risk of bias. CONCLUSIONS: The limited, low quality and relatively old evidence suggests that homeless people who drink heavily may be deficient in vitamin C, thiamine, and other nutrients. New, well conducted studies are needed in order to optimally inform public health interventions aimed at improving deficiencies in this population. TRIAL REGISTRATION: PROSPERO CRD42015024247 ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (doi:10.1186/s12939-017-0564-4) contains supplementary material, which is available to authorized users. BioMed Central 2017-05-05 /pmc/articles/PMC5418701/ /pubmed/28476156 http://dx.doi.org/10.1186/s12939-017-0564-4 Text en © The Author(s). 2017 Open AccessThis article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated. |
spellingShingle | Systematic Review Ijaz, Sharea Jackson, Joni Thorley, Helen Porter, Katie Fleming, Clare Richards, Alison Bonner, Adrian Savović, Jelena Nutritional deficiencies in homeless persons with problematic drinking: a systematic review |
title | Nutritional deficiencies in homeless persons with problematic drinking: a systematic review |
title_full | Nutritional deficiencies in homeless persons with problematic drinking: a systematic review |
title_fullStr | Nutritional deficiencies in homeless persons with problematic drinking: a systematic review |
title_full_unstemmed | Nutritional deficiencies in homeless persons with problematic drinking: a systematic review |
title_short | Nutritional deficiencies in homeless persons with problematic drinking: a systematic review |
title_sort | nutritional deficiencies in homeless persons with problematic drinking: a systematic review |
topic | Systematic Review |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5418701/ https://www.ncbi.nlm.nih.gov/pubmed/28476156 http://dx.doi.org/10.1186/s12939-017-0564-4 |
work_keys_str_mv | AT ijazsharea nutritionaldeficienciesinhomelesspersonswithproblematicdrinkingasystematicreview AT jacksonjoni nutritionaldeficienciesinhomelesspersonswithproblematicdrinkingasystematicreview AT thorleyhelen nutritionaldeficienciesinhomelesspersonswithproblematicdrinkingasystematicreview AT porterkatie nutritionaldeficienciesinhomelesspersonswithproblematicdrinkingasystematicreview AT flemingclare nutritionaldeficienciesinhomelesspersonswithproblematicdrinkingasystematicreview AT richardsalison nutritionaldeficienciesinhomelesspersonswithproblematicdrinkingasystematicreview AT bonneradrian nutritionaldeficienciesinhomelesspersonswithproblematicdrinkingasystematicreview AT savovicjelena nutritionaldeficienciesinhomelesspersonswithproblematicdrinkingasystematicreview |