Cargando…
Recombinant tandem of pore-domains in a Weakly Inward rectifying K(+) channel 2 (TWIK2) forms active lysosomal channels
Recombinant TWIK2 channels produce weak basal background K(+) currents. Current amplitudes depend on the animal species the channels have been isolated from and on the heterologous system used for their re-expression. Here we show that this variability is due to a unique cellular trafficking. We ide...
Autores principales: | , , , , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Nature Publishing Group UK
2017
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5428834/ https://www.ncbi.nlm.nih.gov/pubmed/28381826 http://dx.doi.org/10.1038/s41598-017-00640-8 |
_version_ | 1783235912962932736 |
---|---|
author | Bobak, Nicole Feliciangeli, Sylvain Chen, Cheng-Chang Ben Soussia, Ismail Bittner, Stefan Pagnotta, Sophie Ruck, Tobias Biel, Martin Wahl-Schott, Christian Grimm, Christian Meuth, Sven G. Lesage, Florian |
author_facet | Bobak, Nicole Feliciangeli, Sylvain Chen, Cheng-Chang Ben Soussia, Ismail Bittner, Stefan Pagnotta, Sophie Ruck, Tobias Biel, Martin Wahl-Schott, Christian Grimm, Christian Meuth, Sven G. Lesage, Florian |
author_sort | Bobak, Nicole |
collection | PubMed |
description | Recombinant TWIK2 channels produce weak basal background K(+) currents. Current amplitudes depend on the animal species the channels have been isolated from and on the heterologous system used for their re-expression. Here we show that this variability is due to a unique cellular trafficking. We identified three different sequence signals responsible for the preferential expression of TWIK2 in the Lamp1-positive lysosomal compartment. Sequential inactivation of tyrosine-based (Y(308)ASIP) and di-leucine-like (E(266)LILL and D(282)EDDQVDIL) trafficking motifs progressively abolishes the targeting of TWIK2 to lysosomes, and promotes its functional relocation at the plasma membrane. In addition, TWIK2 contains two N-glycosylation sites (N(79)AS and N(85)AS) on its luminal side, and glycosylation is necessary for expression in lysosomes. As shown by electrophysiology and electron microscopy, TWIK2 produces functional background K(+) currents in the endolysosomes, and its expression affects the number and mean size of the lysosomes. These results show that TWIK2 is expressed in lysosomes, further expanding the registry of ion channels expressed in these organelles. |
format | Online Article Text |
id | pubmed-5428834 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2017 |
publisher | Nature Publishing Group UK |
record_format | MEDLINE/PubMed |
spelling | pubmed-54288342017-05-15 Recombinant tandem of pore-domains in a Weakly Inward rectifying K(+) channel 2 (TWIK2) forms active lysosomal channels Bobak, Nicole Feliciangeli, Sylvain Chen, Cheng-Chang Ben Soussia, Ismail Bittner, Stefan Pagnotta, Sophie Ruck, Tobias Biel, Martin Wahl-Schott, Christian Grimm, Christian Meuth, Sven G. Lesage, Florian Sci Rep Article Recombinant TWIK2 channels produce weak basal background K(+) currents. Current amplitudes depend on the animal species the channels have been isolated from and on the heterologous system used for their re-expression. Here we show that this variability is due to a unique cellular trafficking. We identified three different sequence signals responsible for the preferential expression of TWIK2 in the Lamp1-positive lysosomal compartment. Sequential inactivation of tyrosine-based (Y(308)ASIP) and di-leucine-like (E(266)LILL and D(282)EDDQVDIL) trafficking motifs progressively abolishes the targeting of TWIK2 to lysosomes, and promotes its functional relocation at the plasma membrane. In addition, TWIK2 contains two N-glycosylation sites (N(79)AS and N(85)AS) on its luminal side, and glycosylation is necessary for expression in lysosomes. As shown by electrophysiology and electron microscopy, TWIK2 produces functional background K(+) currents in the endolysosomes, and its expression affects the number and mean size of the lysosomes. These results show that TWIK2 is expressed in lysosomes, further expanding the registry of ion channels expressed in these organelles. Nature Publishing Group UK 2017-04-05 /pmc/articles/PMC5428834/ /pubmed/28381826 http://dx.doi.org/10.1038/s41598-017-00640-8 Text en © The Author(s) 2017 Open Access This article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The images or other third party material in this article are included in the article’s Creative Commons license, unless indicated otherwise in a credit line to the material. If material is not included in the article’s Creative Commons license and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this license, visit http://creativecommons.org/licenses/by/4.0/. |
spellingShingle | Article Bobak, Nicole Feliciangeli, Sylvain Chen, Cheng-Chang Ben Soussia, Ismail Bittner, Stefan Pagnotta, Sophie Ruck, Tobias Biel, Martin Wahl-Schott, Christian Grimm, Christian Meuth, Sven G. Lesage, Florian Recombinant tandem of pore-domains in a Weakly Inward rectifying K(+) channel 2 (TWIK2) forms active lysosomal channels |
title | Recombinant tandem of pore-domains in a Weakly Inward rectifying K(+) channel 2 (TWIK2) forms active lysosomal channels |
title_full | Recombinant tandem of pore-domains in a Weakly Inward rectifying K(+) channel 2 (TWIK2) forms active lysosomal channels |
title_fullStr | Recombinant tandem of pore-domains in a Weakly Inward rectifying K(+) channel 2 (TWIK2) forms active lysosomal channels |
title_full_unstemmed | Recombinant tandem of pore-domains in a Weakly Inward rectifying K(+) channel 2 (TWIK2) forms active lysosomal channels |
title_short | Recombinant tandem of pore-domains in a Weakly Inward rectifying K(+) channel 2 (TWIK2) forms active lysosomal channels |
title_sort | recombinant tandem of pore-domains in a weakly inward rectifying k(+) channel 2 (twik2) forms active lysosomal channels |
topic | Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5428834/ https://www.ncbi.nlm.nih.gov/pubmed/28381826 http://dx.doi.org/10.1038/s41598-017-00640-8 |
work_keys_str_mv | AT bobaknicole recombinanttandemofporedomainsinaweaklyinwardrectifyingkchannel2twik2formsactivelysosomalchannels AT feliciangelisylvain recombinanttandemofporedomainsinaweaklyinwardrectifyingkchannel2twik2formsactivelysosomalchannels AT chenchengchang recombinanttandemofporedomainsinaweaklyinwardrectifyingkchannel2twik2formsactivelysosomalchannels AT bensoussiaismail recombinanttandemofporedomainsinaweaklyinwardrectifyingkchannel2twik2formsactivelysosomalchannels AT bittnerstefan recombinanttandemofporedomainsinaweaklyinwardrectifyingkchannel2twik2formsactivelysosomalchannels AT pagnottasophie recombinanttandemofporedomainsinaweaklyinwardrectifyingkchannel2twik2formsactivelysosomalchannels AT rucktobias recombinanttandemofporedomainsinaweaklyinwardrectifyingkchannel2twik2formsactivelysosomalchannels AT bielmartin recombinanttandemofporedomainsinaweaklyinwardrectifyingkchannel2twik2formsactivelysosomalchannels AT wahlschottchristian recombinanttandemofporedomainsinaweaklyinwardrectifyingkchannel2twik2formsactivelysosomalchannels AT grimmchristian recombinanttandemofporedomainsinaweaklyinwardrectifyingkchannel2twik2formsactivelysosomalchannels AT meuthsveng recombinanttandemofporedomainsinaweaklyinwardrectifyingkchannel2twik2formsactivelysosomalchannels AT lesageflorian recombinanttandemofporedomainsinaweaklyinwardrectifyingkchannel2twik2formsactivelysosomalchannels |