Cargando…

Losing a jewel—Rapid declines in Myanmar’s intact forests from 2002-2014

New and rapid political and economic changes in Myanmar are increasing the pressures on the country’s forests. Yet, little is known about the past and current condition of these forests and how fast they are declining. We mapped forest cover in Myanmar through a consortium of international organizat...

Descripción completa

Detalles Bibliográficos
Autores principales: Bhagwat, Tejas, Hess, Andrea, Horning, Ned, Khaing, Thiri, Thein, Zaw Min, Aung, Kyaw Moe, Aung, Kyaw Htet, Phyo, Paing, Tun, Ye Lin, Oo, Aung Htat, Neil, Anthony, Thu, Win Myo, Songer, Melissa, LaJeunesse Connette, Katherine, Bernd, Asja, Huang, Qiongyu, Connette, Grant, Leimgruber, Peter
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Public Library of Science 2017
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5435175/
https://www.ncbi.nlm.nih.gov/pubmed/28520726
http://dx.doi.org/10.1371/journal.pone.0176364
_version_ 1783237186179563520
author Bhagwat, Tejas
Hess, Andrea
Horning, Ned
Khaing, Thiri
Thein, Zaw Min
Aung, Kyaw Moe
Aung, Kyaw Htet
Phyo, Paing
Tun, Ye Lin
Oo, Aung Htat
Neil, Anthony
Thu, Win Myo
Songer, Melissa
LaJeunesse Connette, Katherine
Bernd, Asja
Huang, Qiongyu
Connette, Grant
Leimgruber, Peter
author_facet Bhagwat, Tejas
Hess, Andrea
Horning, Ned
Khaing, Thiri
Thein, Zaw Min
Aung, Kyaw Moe
Aung, Kyaw Htet
Phyo, Paing
Tun, Ye Lin
Oo, Aung Htat
Neil, Anthony
Thu, Win Myo
Songer, Melissa
LaJeunesse Connette, Katherine
Bernd, Asja
Huang, Qiongyu
Connette, Grant
Leimgruber, Peter
author_sort Bhagwat, Tejas
collection PubMed
description New and rapid political and economic changes in Myanmar are increasing the pressures on the country’s forests. Yet, little is known about the past and current condition of these forests and how fast they are declining. We mapped forest cover in Myanmar through a consortium of international organizations and environmental non-governmental groups, using freely-available public domain data and open source software tools. We used Landsat satellite imagery to assess the condition and spatial distribution of Myanmar’s intact and degraded forests with special focus on changes in intact forest between 2002 and 2014. We found that forests cover 42,365,729 ha or 63% of Myanmar, making it one of the most forested countries in the region. However, severe logging, expanding plantations, and degradation pose increasing threats. Only 38% of the country’s forests can be considered intact with canopy cover >80%. Between 2002 and 2014, intact forests declined at a rate of 0.94% annually, totaling more than 2 million ha forest loss. Losses can be extremely high locally and we identified 9 townships as forest conversion hotspots. We also delineated 13 large (>100,000 ha) and contiguous intact forest landscapes, which are dispersed across Myanmar. The Northern Forest Complex supports four of these landscapes, totaling over 6.1 million ha of intact forest, followed by the Southern Forest Complex with three landscapes, comprising 1.5 million ha. These remaining contiguous forest landscape should have high priority for protection. Our project demonstrates how open source data and software can be used to develop and share critical information on forests when such data are not readily available elsewhere. We provide all data, code, and outputs freely via the internet at (for scripts: https://bitbucket.org/rsbiodiv/; for the data: http://geonode.themimu.info/layers/geonode%3Amyan_lvl2_smoothed_dec2015_resamp)
format Online
Article
Text
id pubmed-5435175
institution National Center for Biotechnology Information
language English
publishDate 2017
publisher Public Library of Science
record_format MEDLINE/PubMed
spelling pubmed-54351752017-05-26 Losing a jewel—Rapid declines in Myanmar’s intact forests from 2002-2014 Bhagwat, Tejas Hess, Andrea Horning, Ned Khaing, Thiri Thein, Zaw Min Aung, Kyaw Moe Aung, Kyaw Htet Phyo, Paing Tun, Ye Lin Oo, Aung Htat Neil, Anthony Thu, Win Myo Songer, Melissa LaJeunesse Connette, Katherine Bernd, Asja Huang, Qiongyu Connette, Grant Leimgruber, Peter PLoS One Research Article New and rapid political and economic changes in Myanmar are increasing the pressures on the country’s forests. Yet, little is known about the past and current condition of these forests and how fast they are declining. We mapped forest cover in Myanmar through a consortium of international organizations and environmental non-governmental groups, using freely-available public domain data and open source software tools. We used Landsat satellite imagery to assess the condition and spatial distribution of Myanmar’s intact and degraded forests with special focus on changes in intact forest between 2002 and 2014. We found that forests cover 42,365,729 ha or 63% of Myanmar, making it one of the most forested countries in the region. However, severe logging, expanding plantations, and degradation pose increasing threats. Only 38% of the country’s forests can be considered intact with canopy cover >80%. Between 2002 and 2014, intact forests declined at a rate of 0.94% annually, totaling more than 2 million ha forest loss. Losses can be extremely high locally and we identified 9 townships as forest conversion hotspots. We also delineated 13 large (>100,000 ha) and contiguous intact forest landscapes, which are dispersed across Myanmar. The Northern Forest Complex supports four of these landscapes, totaling over 6.1 million ha of intact forest, followed by the Southern Forest Complex with three landscapes, comprising 1.5 million ha. These remaining contiguous forest landscape should have high priority for protection. Our project demonstrates how open source data and software can be used to develop and share critical information on forests when such data are not readily available elsewhere. We provide all data, code, and outputs freely via the internet at (for scripts: https://bitbucket.org/rsbiodiv/; for the data: http://geonode.themimu.info/layers/geonode%3Amyan_lvl2_smoothed_dec2015_resamp) Public Library of Science 2017-05-17 /pmc/articles/PMC5435175/ /pubmed/28520726 http://dx.doi.org/10.1371/journal.pone.0176364 Text en https://creativecommons.org/publicdomain/zero/1.0/ This is an open access article, free of all copyright, and may be freely reproduced, distributed, transmitted, modified, built upon, or otherwise used by anyone for any lawful purpose. The work is made available under the Creative Commons CC0 (https://creativecommons.org/publicdomain/zero/1.0/) public domain dedication.
spellingShingle Research Article
Bhagwat, Tejas
Hess, Andrea
Horning, Ned
Khaing, Thiri
Thein, Zaw Min
Aung, Kyaw Moe
Aung, Kyaw Htet
Phyo, Paing
Tun, Ye Lin
Oo, Aung Htat
Neil, Anthony
Thu, Win Myo
Songer, Melissa
LaJeunesse Connette, Katherine
Bernd, Asja
Huang, Qiongyu
Connette, Grant
Leimgruber, Peter
Losing a jewel—Rapid declines in Myanmar’s intact forests from 2002-2014
title Losing a jewel—Rapid declines in Myanmar’s intact forests from 2002-2014
title_full Losing a jewel—Rapid declines in Myanmar’s intact forests from 2002-2014
title_fullStr Losing a jewel—Rapid declines in Myanmar’s intact forests from 2002-2014
title_full_unstemmed Losing a jewel—Rapid declines in Myanmar’s intact forests from 2002-2014
title_short Losing a jewel—Rapid declines in Myanmar’s intact forests from 2002-2014
title_sort losing a jewel—rapid declines in myanmar’s intact forests from 2002-2014
topic Research Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5435175/
https://www.ncbi.nlm.nih.gov/pubmed/28520726
http://dx.doi.org/10.1371/journal.pone.0176364
work_keys_str_mv AT bhagwattejas losingajewelrapiddeclinesinmyanmarsintactforestsfrom20022014
AT hessandrea losingajewelrapiddeclinesinmyanmarsintactforestsfrom20022014
AT horningned losingajewelrapiddeclinesinmyanmarsintactforestsfrom20022014
AT khaingthiri losingajewelrapiddeclinesinmyanmarsintactforestsfrom20022014
AT theinzawmin losingajewelrapiddeclinesinmyanmarsintactforestsfrom20022014
AT aungkyawmoe losingajewelrapiddeclinesinmyanmarsintactforestsfrom20022014
AT aungkyawhtet losingajewelrapiddeclinesinmyanmarsintactforestsfrom20022014
AT phyopaing losingajewelrapiddeclinesinmyanmarsintactforestsfrom20022014
AT tunyelin losingajewelrapiddeclinesinmyanmarsintactforestsfrom20022014
AT ooaunghtat losingajewelrapiddeclinesinmyanmarsintactforestsfrom20022014
AT neilanthony losingajewelrapiddeclinesinmyanmarsintactforestsfrom20022014
AT thuwinmyo losingajewelrapiddeclinesinmyanmarsintactforestsfrom20022014
AT songermelissa losingajewelrapiddeclinesinmyanmarsintactforestsfrom20022014
AT lajeunesseconnettekatherine losingajewelrapiddeclinesinmyanmarsintactforestsfrom20022014
AT berndasja losingajewelrapiddeclinesinmyanmarsintactforestsfrom20022014
AT huangqiongyu losingajewelrapiddeclinesinmyanmarsintactforestsfrom20022014
AT connettegrant losingajewelrapiddeclinesinmyanmarsintactforestsfrom20022014
AT leimgruberpeter losingajewelrapiddeclinesinmyanmarsintactforestsfrom20022014