Cargando…
Losing a jewel—Rapid declines in Myanmar’s intact forests from 2002-2014
New and rapid political and economic changes in Myanmar are increasing the pressures on the country’s forests. Yet, little is known about the past and current condition of these forests and how fast they are declining. We mapped forest cover in Myanmar through a consortium of international organizat...
Autores principales: | , , , , , , , , , , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Public Library of Science
2017
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5435175/ https://www.ncbi.nlm.nih.gov/pubmed/28520726 http://dx.doi.org/10.1371/journal.pone.0176364 |
_version_ | 1783237186179563520 |
---|---|
author | Bhagwat, Tejas Hess, Andrea Horning, Ned Khaing, Thiri Thein, Zaw Min Aung, Kyaw Moe Aung, Kyaw Htet Phyo, Paing Tun, Ye Lin Oo, Aung Htat Neil, Anthony Thu, Win Myo Songer, Melissa LaJeunesse Connette, Katherine Bernd, Asja Huang, Qiongyu Connette, Grant Leimgruber, Peter |
author_facet | Bhagwat, Tejas Hess, Andrea Horning, Ned Khaing, Thiri Thein, Zaw Min Aung, Kyaw Moe Aung, Kyaw Htet Phyo, Paing Tun, Ye Lin Oo, Aung Htat Neil, Anthony Thu, Win Myo Songer, Melissa LaJeunesse Connette, Katherine Bernd, Asja Huang, Qiongyu Connette, Grant Leimgruber, Peter |
author_sort | Bhagwat, Tejas |
collection | PubMed |
description | New and rapid political and economic changes in Myanmar are increasing the pressures on the country’s forests. Yet, little is known about the past and current condition of these forests and how fast they are declining. We mapped forest cover in Myanmar through a consortium of international organizations and environmental non-governmental groups, using freely-available public domain data and open source software tools. We used Landsat satellite imagery to assess the condition and spatial distribution of Myanmar’s intact and degraded forests with special focus on changes in intact forest between 2002 and 2014. We found that forests cover 42,365,729 ha or 63% of Myanmar, making it one of the most forested countries in the region. However, severe logging, expanding plantations, and degradation pose increasing threats. Only 38% of the country’s forests can be considered intact with canopy cover >80%. Between 2002 and 2014, intact forests declined at a rate of 0.94% annually, totaling more than 2 million ha forest loss. Losses can be extremely high locally and we identified 9 townships as forest conversion hotspots. We also delineated 13 large (>100,000 ha) and contiguous intact forest landscapes, which are dispersed across Myanmar. The Northern Forest Complex supports four of these landscapes, totaling over 6.1 million ha of intact forest, followed by the Southern Forest Complex with three landscapes, comprising 1.5 million ha. These remaining contiguous forest landscape should have high priority for protection. Our project demonstrates how open source data and software can be used to develop and share critical information on forests when such data are not readily available elsewhere. We provide all data, code, and outputs freely via the internet at (for scripts: https://bitbucket.org/rsbiodiv/; for the data: http://geonode.themimu.info/layers/geonode%3Amyan_lvl2_smoothed_dec2015_resamp) |
format | Online Article Text |
id | pubmed-5435175 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2017 |
publisher | Public Library of Science |
record_format | MEDLINE/PubMed |
spelling | pubmed-54351752017-05-26 Losing a jewel—Rapid declines in Myanmar’s intact forests from 2002-2014 Bhagwat, Tejas Hess, Andrea Horning, Ned Khaing, Thiri Thein, Zaw Min Aung, Kyaw Moe Aung, Kyaw Htet Phyo, Paing Tun, Ye Lin Oo, Aung Htat Neil, Anthony Thu, Win Myo Songer, Melissa LaJeunesse Connette, Katherine Bernd, Asja Huang, Qiongyu Connette, Grant Leimgruber, Peter PLoS One Research Article New and rapid political and economic changes in Myanmar are increasing the pressures on the country’s forests. Yet, little is known about the past and current condition of these forests and how fast they are declining. We mapped forest cover in Myanmar through a consortium of international organizations and environmental non-governmental groups, using freely-available public domain data and open source software tools. We used Landsat satellite imagery to assess the condition and spatial distribution of Myanmar’s intact and degraded forests with special focus on changes in intact forest between 2002 and 2014. We found that forests cover 42,365,729 ha or 63% of Myanmar, making it one of the most forested countries in the region. However, severe logging, expanding plantations, and degradation pose increasing threats. Only 38% of the country’s forests can be considered intact with canopy cover >80%. Between 2002 and 2014, intact forests declined at a rate of 0.94% annually, totaling more than 2 million ha forest loss. Losses can be extremely high locally and we identified 9 townships as forest conversion hotspots. We also delineated 13 large (>100,000 ha) and contiguous intact forest landscapes, which are dispersed across Myanmar. The Northern Forest Complex supports four of these landscapes, totaling over 6.1 million ha of intact forest, followed by the Southern Forest Complex with three landscapes, comprising 1.5 million ha. These remaining contiguous forest landscape should have high priority for protection. Our project demonstrates how open source data and software can be used to develop and share critical information on forests when such data are not readily available elsewhere. We provide all data, code, and outputs freely via the internet at (for scripts: https://bitbucket.org/rsbiodiv/; for the data: http://geonode.themimu.info/layers/geonode%3Amyan_lvl2_smoothed_dec2015_resamp) Public Library of Science 2017-05-17 /pmc/articles/PMC5435175/ /pubmed/28520726 http://dx.doi.org/10.1371/journal.pone.0176364 Text en https://creativecommons.org/publicdomain/zero/1.0/ This is an open access article, free of all copyright, and may be freely reproduced, distributed, transmitted, modified, built upon, or otherwise used by anyone for any lawful purpose. The work is made available under the Creative Commons CC0 (https://creativecommons.org/publicdomain/zero/1.0/) public domain dedication. |
spellingShingle | Research Article Bhagwat, Tejas Hess, Andrea Horning, Ned Khaing, Thiri Thein, Zaw Min Aung, Kyaw Moe Aung, Kyaw Htet Phyo, Paing Tun, Ye Lin Oo, Aung Htat Neil, Anthony Thu, Win Myo Songer, Melissa LaJeunesse Connette, Katherine Bernd, Asja Huang, Qiongyu Connette, Grant Leimgruber, Peter Losing a jewel—Rapid declines in Myanmar’s intact forests from 2002-2014 |
title | Losing a jewel—Rapid declines in Myanmar’s intact forests from 2002-2014 |
title_full | Losing a jewel—Rapid declines in Myanmar’s intact forests from 2002-2014 |
title_fullStr | Losing a jewel—Rapid declines in Myanmar’s intact forests from 2002-2014 |
title_full_unstemmed | Losing a jewel—Rapid declines in Myanmar’s intact forests from 2002-2014 |
title_short | Losing a jewel—Rapid declines in Myanmar’s intact forests from 2002-2014 |
title_sort | losing a jewel—rapid declines in myanmar’s intact forests from 2002-2014 |
topic | Research Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5435175/ https://www.ncbi.nlm.nih.gov/pubmed/28520726 http://dx.doi.org/10.1371/journal.pone.0176364 |
work_keys_str_mv | AT bhagwattejas losingajewelrapiddeclinesinmyanmarsintactforestsfrom20022014 AT hessandrea losingajewelrapiddeclinesinmyanmarsintactforestsfrom20022014 AT horningned losingajewelrapiddeclinesinmyanmarsintactforestsfrom20022014 AT khaingthiri losingajewelrapiddeclinesinmyanmarsintactforestsfrom20022014 AT theinzawmin losingajewelrapiddeclinesinmyanmarsintactforestsfrom20022014 AT aungkyawmoe losingajewelrapiddeclinesinmyanmarsintactforestsfrom20022014 AT aungkyawhtet losingajewelrapiddeclinesinmyanmarsintactforestsfrom20022014 AT phyopaing losingajewelrapiddeclinesinmyanmarsintactforestsfrom20022014 AT tunyelin losingajewelrapiddeclinesinmyanmarsintactforestsfrom20022014 AT ooaunghtat losingajewelrapiddeclinesinmyanmarsintactforestsfrom20022014 AT neilanthony losingajewelrapiddeclinesinmyanmarsintactforestsfrom20022014 AT thuwinmyo losingajewelrapiddeclinesinmyanmarsintactforestsfrom20022014 AT songermelissa losingajewelrapiddeclinesinmyanmarsintactforestsfrom20022014 AT lajeunesseconnettekatherine losingajewelrapiddeclinesinmyanmarsintactforestsfrom20022014 AT berndasja losingajewelrapiddeclinesinmyanmarsintactforestsfrom20022014 AT huangqiongyu losingajewelrapiddeclinesinmyanmarsintactforestsfrom20022014 AT connettegrant losingajewelrapiddeclinesinmyanmarsintactforestsfrom20022014 AT leimgruberpeter losingajewelrapiddeclinesinmyanmarsintactforestsfrom20022014 |