Cargando…
Prevalence of chronic kidney disease markers: Evidence from a three-million married population with fertility desire in rural China
We aimed to assess the prevalence of chronic kidney diseases (CKD) markers among the married residents with fertility desire in rural China. Demographic and clinical data were collected from the National Free Pre-Conception Health Examination Project. Estimated glomerular filtration rate (eGFR) <...
Autores principales: | , , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Nature Publishing Group UK
2017
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5457424/ https://www.ncbi.nlm.nih.gov/pubmed/28578426 http://dx.doi.org/10.1038/s41598-017-02355-2 |
_version_ | 1783241532079341568 |
---|---|
author | Du, Ye Zhang, Shikun Hu, Mei Wang, Qiaomei Shen, Haiping Zhang, Yiping Yan, Donghai Li, Yuanyuan Zhang, Man Meng, Qun |
author_facet | Du, Ye Zhang, Shikun Hu, Mei Wang, Qiaomei Shen, Haiping Zhang, Yiping Yan, Donghai Li, Yuanyuan Zhang, Man Meng, Qun |
author_sort | Du, Ye |
collection | PubMed |
description | We aimed to assess the prevalence of chronic kidney diseases (CKD) markers among the married residents with fertility desire in rural China. Demographic and clinical data were collected from the National Free Pre-Conception Health Examination Project. Estimated glomerular filtration rate (eGFR) < 60 mL/min//1.73 m(2), proteinuria, and hematuria were defined as markers of CKD. GFR was evaluated by using serum creatinine level and the Asian-modified CKD epidemiology collaboration equation. Automated urine dry chemical and microscopic analyses were employed to identify proteinuria and hematuria. The prevalence of CKD markers was 2.92% in the 3,091,379 participants. eGFR < 60 mL/min//1.73 m(2), hematuria and proteinuria was observed in 0.85%, 1.41% and 0.71%, respectively. The prevalence of CKD markers varied greatly across different geographical locations, which was the highest in the Eastern Region (3.86%; 95% confidence interval [CI]: 3.81–3.91%), moderate in the Central Region (2.80%; 95% CI: 2.77–2.82%), and lowest in the Western Region (2.62%; 95% CI: 2.59–2.65%). Hypertension, obesity, positive hepatitis B virus surface antigen (HBsAg), age (increased by every 5 years), female gender, and living area were potential risk factors for CKD. In rural China, the prevalence of CKD markers in the married couples with fertility desire is low. |
format | Online Article Text |
id | pubmed-5457424 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2017 |
publisher | Nature Publishing Group UK |
record_format | MEDLINE/PubMed |
spelling | pubmed-54574242017-06-06 Prevalence of chronic kidney disease markers: Evidence from a three-million married population with fertility desire in rural China Du, Ye Zhang, Shikun Hu, Mei Wang, Qiaomei Shen, Haiping Zhang, Yiping Yan, Donghai Li, Yuanyuan Zhang, Man Meng, Qun Sci Rep Article We aimed to assess the prevalence of chronic kidney diseases (CKD) markers among the married residents with fertility desire in rural China. Demographic and clinical data were collected from the National Free Pre-Conception Health Examination Project. Estimated glomerular filtration rate (eGFR) < 60 mL/min//1.73 m(2), proteinuria, and hematuria were defined as markers of CKD. GFR was evaluated by using serum creatinine level and the Asian-modified CKD epidemiology collaboration equation. Automated urine dry chemical and microscopic analyses were employed to identify proteinuria and hematuria. The prevalence of CKD markers was 2.92% in the 3,091,379 participants. eGFR < 60 mL/min//1.73 m(2), hematuria and proteinuria was observed in 0.85%, 1.41% and 0.71%, respectively. The prevalence of CKD markers varied greatly across different geographical locations, which was the highest in the Eastern Region (3.86%; 95% confidence interval [CI]: 3.81–3.91%), moderate in the Central Region (2.80%; 95% CI: 2.77–2.82%), and lowest in the Western Region (2.62%; 95% CI: 2.59–2.65%). Hypertension, obesity, positive hepatitis B virus surface antigen (HBsAg), age (increased by every 5 years), female gender, and living area were potential risk factors for CKD. In rural China, the prevalence of CKD markers in the married couples with fertility desire is low. Nature Publishing Group UK 2017-06-02 /pmc/articles/PMC5457424/ /pubmed/28578426 http://dx.doi.org/10.1038/s41598-017-02355-2 Text en © The Author(s) 2017 Open Access This article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The images or other third party material in this article are included in the article’s Creative Commons license, unless indicated otherwise in a credit line to the material. If material is not included in the article’s Creative Commons license and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this license, visit http://creativecommons.org/licenses/by/4.0/. |
spellingShingle | Article Du, Ye Zhang, Shikun Hu, Mei Wang, Qiaomei Shen, Haiping Zhang, Yiping Yan, Donghai Li, Yuanyuan Zhang, Man Meng, Qun Prevalence of chronic kidney disease markers: Evidence from a three-million married population with fertility desire in rural China |
title | Prevalence of chronic kidney disease markers: Evidence from a three-million married population with fertility desire in rural China |
title_full | Prevalence of chronic kidney disease markers: Evidence from a three-million married population with fertility desire in rural China |
title_fullStr | Prevalence of chronic kidney disease markers: Evidence from a three-million married population with fertility desire in rural China |
title_full_unstemmed | Prevalence of chronic kidney disease markers: Evidence from a three-million married population with fertility desire in rural China |
title_short | Prevalence of chronic kidney disease markers: Evidence from a three-million married population with fertility desire in rural China |
title_sort | prevalence of chronic kidney disease markers: evidence from a three-million married population with fertility desire in rural china |
topic | Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5457424/ https://www.ncbi.nlm.nih.gov/pubmed/28578426 http://dx.doi.org/10.1038/s41598-017-02355-2 |
work_keys_str_mv | AT duye prevalenceofchronickidneydiseasemarkersevidencefromathreemillionmarriedpopulationwithfertilitydesireinruralchina AT zhangshikun prevalenceofchronickidneydiseasemarkersevidencefromathreemillionmarriedpopulationwithfertilitydesireinruralchina AT humei prevalenceofchronickidneydiseasemarkersevidencefromathreemillionmarriedpopulationwithfertilitydesireinruralchina AT wangqiaomei prevalenceofchronickidneydiseasemarkersevidencefromathreemillionmarriedpopulationwithfertilitydesireinruralchina AT shenhaiping prevalenceofchronickidneydiseasemarkersevidencefromathreemillionmarriedpopulationwithfertilitydesireinruralchina AT zhangyiping prevalenceofchronickidneydiseasemarkersevidencefromathreemillionmarriedpopulationwithfertilitydesireinruralchina AT yandonghai prevalenceofchronickidneydiseasemarkersevidencefromathreemillionmarriedpopulationwithfertilitydesireinruralchina AT liyuanyuan prevalenceofchronickidneydiseasemarkersevidencefromathreemillionmarriedpopulationwithfertilitydesireinruralchina AT zhangman prevalenceofchronickidneydiseasemarkersevidencefromathreemillionmarriedpopulationwithfertilitydesireinruralchina AT mengqun prevalenceofchronickidneydiseasemarkersevidencefromathreemillionmarriedpopulationwithfertilitydesireinruralchina |