Cargando…
Zinc Finger E-Box Binding Protein 2 (ZEB2) Suppress Apoptosis of Vascular Endothelial Cells Induced by High Glucose Through Mitogen-Activated Protein Kinases (MAPK) Pathway Activation
BACKGROUND: Hyperglycemia has been confirmed to damage endothelial function of vascular and microvascular. The regulation of zinc finger E-box binding protein 2 (ZEB2) on vascular endothelial cells (VECs) is reported rarely. Our study investigates the role of ZEB2 on the apoptosis of VECs induced by...
Autores principales: | , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
International Scientific Literature, Inc.
2017
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5459269/ https://www.ncbi.nlm.nih.gov/pubmed/28551696 http://dx.doi.org/10.12659/MSM.904678 |
_version_ | 1783241943026761728 |
---|---|
author | Wang, Lin-Jun Wu, Zi-Heng Zheng, Xiang-Tao Long, Jian-Yun Dong, Yang-Min Fang, Xin |
author_facet | Wang, Lin-Jun Wu, Zi-Heng Zheng, Xiang-Tao Long, Jian-Yun Dong, Yang-Min Fang, Xin |
author_sort | Wang, Lin-Jun |
collection | PubMed |
description | BACKGROUND: Hyperglycemia has been confirmed to damage endothelial function of vascular and microvascular. The regulation of zinc finger E-box binding protein 2 (ZEB2) on vascular endothelial cells (VECs) is reported rarely. Our study investigates the role of ZEB2 on the apoptosis of VECs induced by high glucose through MAPK pathway. MATERIAL/METHODS: Downregulated and upregulated expression of ZEB2 in human umbilical vein endothelial cells (HUVECs) were performed by plasmids transfection. HUVECs are respectively treated with different concentrations of glucose (5.5 mM, 33 mM). The expression of mRNA and protein were detected by real-time quantified PCR and western blotting. Apoptotic cells were measured by flow cytometry. Proliferation and migration of HUVECs were detected by MTT assay and wound healing assay. RESULTS: The apoptosis of HUVECs detected by flow cytometry and western blot revealed that ZEB2 overexpression distinctly suppressed the apoptosis of HUVECs induced by high glucose. ZEB2 overexpression promoted the proliferative and migration activity of HUVECs. Besides, ZEB2 overexpression specifically accelerated the phosphorylation level of JNK, and suppressed the apoptosis and promoted the proliferative of VECs via JNK pathway. CONCLUSION: ZEB2 suppress apoptosis of VECs induced by high glucose through MAPK pathway activation, which provides a novel insight and therapeutic target for endothelial injury. |
format | Online Article Text |
id | pubmed-5459269 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2017 |
publisher | International Scientific Literature, Inc. |
record_format | MEDLINE/PubMed |
spelling | pubmed-54592692017-06-13 Zinc Finger E-Box Binding Protein 2 (ZEB2) Suppress Apoptosis of Vascular Endothelial Cells Induced by High Glucose Through Mitogen-Activated Protein Kinases (MAPK) Pathway Activation Wang, Lin-Jun Wu, Zi-Heng Zheng, Xiang-Tao Long, Jian-Yun Dong, Yang-Min Fang, Xin Med Sci Monit Lab/In Vitro Research BACKGROUND: Hyperglycemia has been confirmed to damage endothelial function of vascular and microvascular. The regulation of zinc finger E-box binding protein 2 (ZEB2) on vascular endothelial cells (VECs) is reported rarely. Our study investigates the role of ZEB2 on the apoptosis of VECs induced by high glucose through MAPK pathway. MATERIAL/METHODS: Downregulated and upregulated expression of ZEB2 in human umbilical vein endothelial cells (HUVECs) were performed by plasmids transfection. HUVECs are respectively treated with different concentrations of glucose (5.5 mM, 33 mM). The expression of mRNA and protein were detected by real-time quantified PCR and western blotting. Apoptotic cells were measured by flow cytometry. Proliferation and migration of HUVECs were detected by MTT assay and wound healing assay. RESULTS: The apoptosis of HUVECs detected by flow cytometry and western blot revealed that ZEB2 overexpression distinctly suppressed the apoptosis of HUVECs induced by high glucose. ZEB2 overexpression promoted the proliferative and migration activity of HUVECs. Besides, ZEB2 overexpression specifically accelerated the phosphorylation level of JNK, and suppressed the apoptosis and promoted the proliferative of VECs via JNK pathway. CONCLUSION: ZEB2 suppress apoptosis of VECs induced by high glucose through MAPK pathway activation, which provides a novel insight and therapeutic target for endothelial injury. International Scientific Literature, Inc. 2017-05-28 /pmc/articles/PMC5459269/ /pubmed/28551696 http://dx.doi.org/10.12659/MSM.904678 Text en © Med Sci Monit, 2017 This work is licensed under Creative Common Attribution-NonCommercial-NoDerivatives 4.0 International (CC BY-NC-ND 4.0 (https://creativecommons.org/licenses/by-nc-nd/4.0/) ) |
spellingShingle | Lab/In Vitro Research Wang, Lin-Jun Wu, Zi-Heng Zheng, Xiang-Tao Long, Jian-Yun Dong, Yang-Min Fang, Xin Zinc Finger E-Box Binding Protein 2 (ZEB2) Suppress Apoptosis of Vascular Endothelial Cells Induced by High Glucose Through Mitogen-Activated Protein Kinases (MAPK) Pathway Activation |
title | Zinc Finger E-Box Binding Protein 2 (ZEB2) Suppress Apoptosis of Vascular Endothelial Cells Induced by High Glucose Through Mitogen-Activated Protein Kinases (MAPK) Pathway Activation |
title_full | Zinc Finger E-Box Binding Protein 2 (ZEB2) Suppress Apoptosis of Vascular Endothelial Cells Induced by High Glucose Through Mitogen-Activated Protein Kinases (MAPK) Pathway Activation |
title_fullStr | Zinc Finger E-Box Binding Protein 2 (ZEB2) Suppress Apoptosis of Vascular Endothelial Cells Induced by High Glucose Through Mitogen-Activated Protein Kinases (MAPK) Pathway Activation |
title_full_unstemmed | Zinc Finger E-Box Binding Protein 2 (ZEB2) Suppress Apoptosis of Vascular Endothelial Cells Induced by High Glucose Through Mitogen-Activated Protein Kinases (MAPK) Pathway Activation |
title_short | Zinc Finger E-Box Binding Protein 2 (ZEB2) Suppress Apoptosis of Vascular Endothelial Cells Induced by High Glucose Through Mitogen-Activated Protein Kinases (MAPK) Pathway Activation |
title_sort | zinc finger e-box binding protein 2 (zeb2) suppress apoptosis of vascular endothelial cells induced by high glucose through mitogen-activated protein kinases (mapk) pathway activation |
topic | Lab/In Vitro Research |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5459269/ https://www.ncbi.nlm.nih.gov/pubmed/28551696 http://dx.doi.org/10.12659/MSM.904678 |
work_keys_str_mv | AT wanglinjun zincfingereboxbindingprotein2zeb2suppressapoptosisofvascularendothelialcellsinducedbyhighglucosethroughmitogenactivatedproteinkinasesmapkpathwayactivation AT wuziheng zincfingereboxbindingprotein2zeb2suppressapoptosisofvascularendothelialcellsinducedbyhighglucosethroughmitogenactivatedproteinkinasesmapkpathwayactivation AT zhengxiangtao zincfingereboxbindingprotein2zeb2suppressapoptosisofvascularendothelialcellsinducedbyhighglucosethroughmitogenactivatedproteinkinasesmapkpathwayactivation AT longjianyun zincfingereboxbindingprotein2zeb2suppressapoptosisofvascularendothelialcellsinducedbyhighglucosethroughmitogenactivatedproteinkinasesmapkpathwayactivation AT dongyangmin zincfingereboxbindingprotein2zeb2suppressapoptosisofvascularendothelialcellsinducedbyhighglucosethroughmitogenactivatedproteinkinasesmapkpathwayactivation AT fangxin zincfingereboxbindingprotein2zeb2suppressapoptosisofvascularendothelialcellsinducedbyhighglucosethroughmitogenactivatedproteinkinasesmapkpathwayactivation |