Cargando…
Parent experiences and information needs relating to procedural pain in children: a systematic review protocol
BACKGROUND: There exist many evidence-based interventions available to manage procedural pain in children and neonates, yet they are severely underutilized. Parents play an important role in the management of their child’s pain; however, many do not possess adequate knowledge of how to effectively d...
Autores principales: | , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2017
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5461670/ https://www.ncbi.nlm.nih.gov/pubmed/28587663 http://dx.doi.org/10.1186/s13643-017-0499-2 |
_version_ | 1783242380125667328 |
---|---|
author | Gates, Allison Shave, Kassi Featherstone, Robin Buckreus, Kelli Ali, Samina Scott, Shannon Hartling, Lisa |
author_facet | Gates, Allison Shave, Kassi Featherstone, Robin Buckreus, Kelli Ali, Samina Scott, Shannon Hartling, Lisa |
author_sort | Gates, Allison |
collection | PubMed |
description | BACKGROUND: There exist many evidence-based interventions available to manage procedural pain in children and neonates, yet they are severely underutilized. Parents play an important role in the management of their child’s pain; however, many do not possess adequate knowledge of how to effectively do so. The purpose of the planned study is to systematically review and synthesize current knowledge of the experiences and information needs of parents with regard to the management of their child’s pain and distress related to medical procedures in the emergency department. METHODS: We will conduct a systematic review using rigorous methods and reporting based on the PRISMA statement. We will conduct a comprehensive search of literature published between 2000 and 2016 reporting on parents’ experiences and information needs with regard to helping their child manage procedural pain and distress. Ovid MEDLINE, Ovid PsycINFO, CINAHL, and PubMed will be searched. We will also search reference lists of key studies and gray literature sources. Two reviewers will screen the articles following inclusion criteria defined a priori. One reviewer will then extract the data from each article following a data extraction form developed by the study team. The second reviewer will check the data extraction for accuracy and completeness. Any disagreements with regard to study inclusion or data extraction will be resolved via discussion. Data from qualitative studies will be summarized thematically, while those from quantitative studies will be summarized narratively. The second reviewer will confirm the overarching themes resulting from the qualitative and quantitative data syntheses. The Critical Appraisal Skills Programme Qualitative Research Checklist and the Quality Assessment Tool for Quantitative Studies will be used to assess the quality of the evidence from each included study. DISCUSSION: To our knowledge, no published review exists that comprehensively reports on the experiences and information needs of parents related to the management of their child’s procedural pain and distress. A systematic review of parents’ experiences and information needs will help to inform strategies to empower them with the knowledge necessary to ensure their child’s comfort during a painful procedure. SYSTEMATIC REVIEW REGISTRATION: PROSPERO CRD42016043698 ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (doi:10.1186/s13643-017-0499-2) contains supplementary material, which is available to authorized users. |
format | Online Article Text |
id | pubmed-5461670 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2017 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-54616702017-06-07 Parent experiences and information needs relating to procedural pain in children: a systematic review protocol Gates, Allison Shave, Kassi Featherstone, Robin Buckreus, Kelli Ali, Samina Scott, Shannon Hartling, Lisa Syst Rev Protocol BACKGROUND: There exist many evidence-based interventions available to manage procedural pain in children and neonates, yet they are severely underutilized. Parents play an important role in the management of their child’s pain; however, many do not possess adequate knowledge of how to effectively do so. The purpose of the planned study is to systematically review and synthesize current knowledge of the experiences and information needs of parents with regard to the management of their child’s pain and distress related to medical procedures in the emergency department. METHODS: We will conduct a systematic review using rigorous methods and reporting based on the PRISMA statement. We will conduct a comprehensive search of literature published between 2000 and 2016 reporting on parents’ experiences and information needs with regard to helping their child manage procedural pain and distress. Ovid MEDLINE, Ovid PsycINFO, CINAHL, and PubMed will be searched. We will also search reference lists of key studies and gray literature sources. Two reviewers will screen the articles following inclusion criteria defined a priori. One reviewer will then extract the data from each article following a data extraction form developed by the study team. The second reviewer will check the data extraction for accuracy and completeness. Any disagreements with regard to study inclusion or data extraction will be resolved via discussion. Data from qualitative studies will be summarized thematically, while those from quantitative studies will be summarized narratively. The second reviewer will confirm the overarching themes resulting from the qualitative and quantitative data syntheses. The Critical Appraisal Skills Programme Qualitative Research Checklist and the Quality Assessment Tool for Quantitative Studies will be used to assess the quality of the evidence from each included study. DISCUSSION: To our knowledge, no published review exists that comprehensively reports on the experiences and information needs of parents related to the management of their child’s procedural pain and distress. A systematic review of parents’ experiences and information needs will help to inform strategies to empower them with the knowledge necessary to ensure their child’s comfort during a painful procedure. SYSTEMATIC REVIEW REGISTRATION: PROSPERO CRD42016043698 ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (doi:10.1186/s13643-017-0499-2) contains supplementary material, which is available to authorized users. BioMed Central 2017-06-06 /pmc/articles/PMC5461670/ /pubmed/28587663 http://dx.doi.org/10.1186/s13643-017-0499-2 Text en © The Author(s). 2017 Open AccessThis article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated. |
spellingShingle | Protocol Gates, Allison Shave, Kassi Featherstone, Robin Buckreus, Kelli Ali, Samina Scott, Shannon Hartling, Lisa Parent experiences and information needs relating to procedural pain in children: a systematic review protocol |
title | Parent experiences and information needs relating to procedural pain in children: a systematic review protocol |
title_full | Parent experiences and information needs relating to procedural pain in children: a systematic review protocol |
title_fullStr | Parent experiences and information needs relating to procedural pain in children: a systematic review protocol |
title_full_unstemmed | Parent experiences and information needs relating to procedural pain in children: a systematic review protocol |
title_short | Parent experiences and information needs relating to procedural pain in children: a systematic review protocol |
title_sort | parent experiences and information needs relating to procedural pain in children: a systematic review protocol |
topic | Protocol |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5461670/ https://www.ncbi.nlm.nih.gov/pubmed/28587663 http://dx.doi.org/10.1186/s13643-017-0499-2 |
work_keys_str_mv | AT gatesallison parentexperiencesandinformationneedsrelatingtoproceduralpaininchildrenasystematicreviewprotocol AT shavekassi parentexperiencesandinformationneedsrelatingtoproceduralpaininchildrenasystematicreviewprotocol AT featherstonerobin parentexperiencesandinformationneedsrelatingtoproceduralpaininchildrenasystematicreviewprotocol AT buckreuskelli parentexperiencesandinformationneedsrelatingtoproceduralpaininchildrenasystematicreviewprotocol AT alisamina parentexperiencesandinformationneedsrelatingtoproceduralpaininchildrenasystematicreviewprotocol AT scottshannon parentexperiencesandinformationneedsrelatingtoproceduralpaininchildrenasystematicreviewprotocol AT hartlinglisa parentexperiencesandinformationneedsrelatingtoproceduralpaininchildrenasystematicreviewprotocol |