Cargando…
Construction of a high-density linkage map and mapping of sex determination and growth-related loci in the mandarin fish (Siniperca chuatsi)
BACKGROUND: The mandarin fish (Siniperca chuatsi) is an important and widely cultured fish in China. However, the lack of selective breeding of mandarin fish in previous decades has resulted in a decline in the growth rate of pond-cultured fish, a shortened period of sexual maturity, and reduced dis...
Autores principales: | , , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2017
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5461734/ https://www.ncbi.nlm.nih.gov/pubmed/28587594 http://dx.doi.org/10.1186/s12864-017-3830-3 |
_version_ | 1783242397047586816 |
---|---|
author | Sun, Chengfei Niu, Yongchaox Ye, Xing Dong, Junjian Hu, Wushu Zeng, Qingkai Chen, Zhihang Tian, Yuanyuan Zhang, Jin Lu, Maixin |
author_facet | Sun, Chengfei Niu, Yongchaox Ye, Xing Dong, Junjian Hu, Wushu Zeng, Qingkai Chen, Zhihang Tian, Yuanyuan Zhang, Jin Lu, Maixin |
author_sort | Sun, Chengfei |
collection | PubMed |
description | BACKGROUND: The mandarin fish (Siniperca chuatsi) is an important and widely cultured fish in China. However, the lack of selective breeding of mandarin fish in previous decades has resulted in a decline in the growth rate of pond-cultured fish, a shortened period of sexual maturity, and reduced disease resistance; these issues seriously affect the quality and safety of the fish products. Therefore, it is necessary to establish a selective breeding program for the mandarin fish to improve the economical traits of the fish and to sustain the development of the mandarin fish industry. RESULTS: We constructed a high-density linkage map for it based on double digest restriction site associated DNA sequencing (ddRAD-Sequencing). This map contained 3283 dimorphic single nucleotide polymorphism markers and 24 linkage groups (LGs). The total map-length was 1972.01 cM, with an average interlocus distance of 0.61 cM. One significant quantitative trait locus (QTL) for sex determination trait was detected on LG23, which was supported by five markers, clustered between 60.27 and 68.71 cM. The highest logarithm of odds value (17.73) was located at 60.27 cM, near the marker r1_73194, accounting for 53.3% of the phenotypic variance. Genotypes of all the male fish on r1_33008 were homozygous, whereas those of all females were heterozygous. Thus, LG23 was considered a sex-related linkage group. Eleven significant QTLs, for three growth traits, at two growth stages and the increased values were distributed on four LGs; their contributions to the phenotypic variation were quite low (12.4–17.2%), suggesting that multiple genes affected the growth traits. CONCLUSION: This high-resolution genetic map provides a valuable resource for fine-mapping of important traits and for identification of sex-related markers that should facilitate breeding of all-female mandarin fish for aquaculture and mechanistic studies on sex determination. ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (doi:10.1186/s12864-017-3830-3) contains supplementary material, which is available to authorized users. |
format | Online Article Text |
id | pubmed-5461734 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2017 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-54617342017-06-07 Construction of a high-density linkage map and mapping of sex determination and growth-related loci in the mandarin fish (Siniperca chuatsi) Sun, Chengfei Niu, Yongchaox Ye, Xing Dong, Junjian Hu, Wushu Zeng, Qingkai Chen, Zhihang Tian, Yuanyuan Zhang, Jin Lu, Maixin BMC Genomics Research Article BACKGROUND: The mandarin fish (Siniperca chuatsi) is an important and widely cultured fish in China. However, the lack of selective breeding of mandarin fish in previous decades has resulted in a decline in the growth rate of pond-cultured fish, a shortened period of sexual maturity, and reduced disease resistance; these issues seriously affect the quality and safety of the fish products. Therefore, it is necessary to establish a selective breeding program for the mandarin fish to improve the economical traits of the fish and to sustain the development of the mandarin fish industry. RESULTS: We constructed a high-density linkage map for it based on double digest restriction site associated DNA sequencing (ddRAD-Sequencing). This map contained 3283 dimorphic single nucleotide polymorphism markers and 24 linkage groups (LGs). The total map-length was 1972.01 cM, with an average interlocus distance of 0.61 cM. One significant quantitative trait locus (QTL) for sex determination trait was detected on LG23, which was supported by five markers, clustered between 60.27 and 68.71 cM. The highest logarithm of odds value (17.73) was located at 60.27 cM, near the marker r1_73194, accounting for 53.3% of the phenotypic variance. Genotypes of all the male fish on r1_33008 were homozygous, whereas those of all females were heterozygous. Thus, LG23 was considered a sex-related linkage group. Eleven significant QTLs, for three growth traits, at two growth stages and the increased values were distributed on four LGs; their contributions to the phenotypic variation were quite low (12.4–17.2%), suggesting that multiple genes affected the growth traits. CONCLUSION: This high-resolution genetic map provides a valuable resource for fine-mapping of important traits and for identification of sex-related markers that should facilitate breeding of all-female mandarin fish for aquaculture and mechanistic studies on sex determination. ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (doi:10.1186/s12864-017-3830-3) contains supplementary material, which is available to authorized users. BioMed Central 2017-06-06 /pmc/articles/PMC5461734/ /pubmed/28587594 http://dx.doi.org/10.1186/s12864-017-3830-3 Text en © The Author(s). 2017 Open AccessThis article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated. |
spellingShingle | Research Article Sun, Chengfei Niu, Yongchaox Ye, Xing Dong, Junjian Hu, Wushu Zeng, Qingkai Chen, Zhihang Tian, Yuanyuan Zhang, Jin Lu, Maixin Construction of a high-density linkage map and mapping of sex determination and growth-related loci in the mandarin fish (Siniperca chuatsi) |
title | Construction of a high-density linkage map and mapping of sex determination and growth-related loci in the mandarin fish (Siniperca chuatsi) |
title_full | Construction of a high-density linkage map and mapping of sex determination and growth-related loci in the mandarin fish (Siniperca chuatsi) |
title_fullStr | Construction of a high-density linkage map and mapping of sex determination and growth-related loci in the mandarin fish (Siniperca chuatsi) |
title_full_unstemmed | Construction of a high-density linkage map and mapping of sex determination and growth-related loci in the mandarin fish (Siniperca chuatsi) |
title_short | Construction of a high-density linkage map and mapping of sex determination and growth-related loci in the mandarin fish (Siniperca chuatsi) |
title_sort | construction of a high-density linkage map and mapping of sex determination and growth-related loci in the mandarin fish (siniperca chuatsi) |
topic | Research Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5461734/ https://www.ncbi.nlm.nih.gov/pubmed/28587594 http://dx.doi.org/10.1186/s12864-017-3830-3 |
work_keys_str_mv | AT sunchengfei constructionofahighdensitylinkagemapandmappingofsexdeterminationandgrowthrelatedlociinthemandarinfishsinipercachuatsi AT niuyongchaox constructionofahighdensitylinkagemapandmappingofsexdeterminationandgrowthrelatedlociinthemandarinfishsinipercachuatsi AT yexing constructionofahighdensitylinkagemapandmappingofsexdeterminationandgrowthrelatedlociinthemandarinfishsinipercachuatsi AT dongjunjian constructionofahighdensitylinkagemapandmappingofsexdeterminationandgrowthrelatedlociinthemandarinfishsinipercachuatsi AT huwushu constructionofahighdensitylinkagemapandmappingofsexdeterminationandgrowthrelatedlociinthemandarinfishsinipercachuatsi AT zengqingkai constructionofahighdensitylinkagemapandmappingofsexdeterminationandgrowthrelatedlociinthemandarinfishsinipercachuatsi AT chenzhihang constructionofahighdensitylinkagemapandmappingofsexdeterminationandgrowthrelatedlociinthemandarinfishsinipercachuatsi AT tianyuanyuan constructionofahighdensitylinkagemapandmappingofsexdeterminationandgrowthrelatedlociinthemandarinfishsinipercachuatsi AT zhangjin constructionofahighdensitylinkagemapandmappingofsexdeterminationandgrowthrelatedlociinthemandarinfishsinipercachuatsi AT lumaixin constructionofahighdensitylinkagemapandmappingofsexdeterminationandgrowthrelatedlociinthemandarinfishsinipercachuatsi |