Cargando…
The CBL and CIPK Gene Family in Grapevine (Vitis vinifera): Genome-Wide Analysis and Expression Profiles in Response to Various Abiotic Stresses
Calcium plays a central role in regulating signal transduction pathways. Calcineurin B-like proteins (CBLs), which harbor a crucial region consisting of EF hands that capture Ca(2+), interact in a specific manner with CBL-interacting protein kinases (CIPKs). This two gene families or their interacti...
Autores principales: | , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Frontiers Media S.A.
2017
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5465270/ https://www.ncbi.nlm.nih.gov/pubmed/28649259 http://dx.doi.org/10.3389/fpls.2017.00978 |
_version_ | 1783242911041716224 |
---|---|
author | Xi, Yue Liu, Jinyi Dong, Chao Cheng, Zong-Ming (Max) |
author_facet | Xi, Yue Liu, Jinyi Dong, Chao Cheng, Zong-Ming (Max) |
author_sort | Xi, Yue |
collection | PubMed |
description | Calcium plays a central role in regulating signal transduction pathways. Calcineurin B-like proteins (CBLs), which harbor a crucial region consisting of EF hands that capture Ca(2+), interact in a specific manner with CBL-interacting protein kinases (CIPKs). This two gene families or their interacting-complex widely respond to various environment stimuli and development processes. The genome-wide annotation and specific expression patterns of CBLs and CIPKs, however, in grapevine remain unclear. In the present study, eight CBL and 20 CIPK genes were identified in grapevine genome, and divided into four and five subfamilies, respectively, based on phylogenetic analysis, and validated by gene structure and the distribution of conserved protein motifs. Four (50%) out of eight VvCBLs and eight (40%) out of 20 VvCIPKs were found to be derived from tandem duplication, and five (25%) out of 20 VvCIPKs were derived from segmental duplication, indicating that the expansion of grapevine CBL and CIPK gene families were mainly contributed by gene duplication, and all duplication events between VvCIPK genes only detected in intron poor clade. Estimating of synonymous and non-synonymous substitution rates of both gene families suggested that VvCBL genes seems more conserved than VvCIPK genes, and were derived by positive selection pressure, whereas VvCIPK genes were mainly derived by purifying selection pressure. Expressional analyses of VvCBL and VvCIPK genes based on microarray and qRT-PCR data performed diverse expression patterns of VvCBLs and VvCIPKs in response to both various abiotic stimuli and at different development stages. Furthermore, the co-expression analysis of grapevine CBLs and CIPKs suggested that CBL-CIPK complex seems to be more responsive to abiotic stimuli than during different development stages. VvCBLs may play an important and special role in regulating low temperature stress. The protein interaction analysis suggested divergent mechanisms might exist between Arabidopsis and grapevine. Our results will facilitate the future functional characterization of individual VvCBLs and VvCIPKs. |
format | Online Article Text |
id | pubmed-5465270 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2017 |
publisher | Frontiers Media S.A. |
record_format | MEDLINE/PubMed |
spelling | pubmed-54652702017-06-23 The CBL and CIPK Gene Family in Grapevine (Vitis vinifera): Genome-Wide Analysis and Expression Profiles in Response to Various Abiotic Stresses Xi, Yue Liu, Jinyi Dong, Chao Cheng, Zong-Ming (Max) Front Plant Sci Plant Science Calcium plays a central role in regulating signal transduction pathways. Calcineurin B-like proteins (CBLs), which harbor a crucial region consisting of EF hands that capture Ca(2+), interact in a specific manner with CBL-interacting protein kinases (CIPKs). This two gene families or their interacting-complex widely respond to various environment stimuli and development processes. The genome-wide annotation and specific expression patterns of CBLs and CIPKs, however, in grapevine remain unclear. In the present study, eight CBL and 20 CIPK genes were identified in grapevine genome, and divided into four and five subfamilies, respectively, based on phylogenetic analysis, and validated by gene structure and the distribution of conserved protein motifs. Four (50%) out of eight VvCBLs and eight (40%) out of 20 VvCIPKs were found to be derived from tandem duplication, and five (25%) out of 20 VvCIPKs were derived from segmental duplication, indicating that the expansion of grapevine CBL and CIPK gene families were mainly contributed by gene duplication, and all duplication events between VvCIPK genes only detected in intron poor clade. Estimating of synonymous and non-synonymous substitution rates of both gene families suggested that VvCBL genes seems more conserved than VvCIPK genes, and were derived by positive selection pressure, whereas VvCIPK genes were mainly derived by purifying selection pressure. Expressional analyses of VvCBL and VvCIPK genes based on microarray and qRT-PCR data performed diverse expression patterns of VvCBLs and VvCIPKs in response to both various abiotic stimuli and at different development stages. Furthermore, the co-expression analysis of grapevine CBLs and CIPKs suggested that CBL-CIPK complex seems to be more responsive to abiotic stimuli than during different development stages. VvCBLs may play an important and special role in regulating low temperature stress. The protein interaction analysis suggested divergent mechanisms might exist between Arabidopsis and grapevine. Our results will facilitate the future functional characterization of individual VvCBLs and VvCIPKs. Frontiers Media S.A. 2017-06-09 /pmc/articles/PMC5465270/ /pubmed/28649259 http://dx.doi.org/10.3389/fpls.2017.00978 Text en Copyright © 2017 Xi, Liu, Dong and Cheng. http://creativecommons.org/licenses/by/4.0/ This is an open-access article distributed under the terms of the Creative Commons Attribution License (CC BY). The use, distribution or reproduction in other forums is permitted, provided the original author(s) or licensor are credited and that the original publication in this journal is cited, in accordance with accepted academic practice. No use, distribution or reproduction is permitted which does not comply with these terms. |
spellingShingle | Plant Science Xi, Yue Liu, Jinyi Dong, Chao Cheng, Zong-Ming (Max) The CBL and CIPK Gene Family in Grapevine (Vitis vinifera): Genome-Wide Analysis and Expression Profiles in Response to Various Abiotic Stresses |
title | The CBL and CIPK Gene Family in Grapevine (Vitis vinifera): Genome-Wide Analysis and Expression Profiles in Response to Various Abiotic Stresses |
title_full | The CBL and CIPK Gene Family in Grapevine (Vitis vinifera): Genome-Wide Analysis and Expression Profiles in Response to Various Abiotic Stresses |
title_fullStr | The CBL and CIPK Gene Family in Grapevine (Vitis vinifera): Genome-Wide Analysis and Expression Profiles in Response to Various Abiotic Stresses |
title_full_unstemmed | The CBL and CIPK Gene Family in Grapevine (Vitis vinifera): Genome-Wide Analysis and Expression Profiles in Response to Various Abiotic Stresses |
title_short | The CBL and CIPK Gene Family in Grapevine (Vitis vinifera): Genome-Wide Analysis and Expression Profiles in Response to Various Abiotic Stresses |
title_sort | cbl and cipk gene family in grapevine (vitis vinifera): genome-wide analysis and expression profiles in response to various abiotic stresses |
topic | Plant Science |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5465270/ https://www.ncbi.nlm.nih.gov/pubmed/28649259 http://dx.doi.org/10.3389/fpls.2017.00978 |
work_keys_str_mv | AT xiyue thecblandcipkgenefamilyingrapevinevitisviniferagenomewideanalysisandexpressionprofilesinresponsetovariousabioticstresses AT liujinyi thecblandcipkgenefamilyingrapevinevitisviniferagenomewideanalysisandexpressionprofilesinresponsetovariousabioticstresses AT dongchao thecblandcipkgenefamilyingrapevinevitisviniferagenomewideanalysisandexpressionprofilesinresponsetovariousabioticstresses AT chengzongmingmax thecblandcipkgenefamilyingrapevinevitisviniferagenomewideanalysisandexpressionprofilesinresponsetovariousabioticstresses AT xiyue cblandcipkgenefamilyingrapevinevitisviniferagenomewideanalysisandexpressionprofilesinresponsetovariousabioticstresses AT liujinyi cblandcipkgenefamilyingrapevinevitisviniferagenomewideanalysisandexpressionprofilesinresponsetovariousabioticstresses AT dongchao cblandcipkgenefamilyingrapevinevitisviniferagenomewideanalysisandexpressionprofilesinresponsetovariousabioticstresses AT chengzongmingmax cblandcipkgenefamilyingrapevinevitisviniferagenomewideanalysisandexpressionprofilesinresponsetovariousabioticstresses |