Cargando…

Vaccatides: Antifungal Glutamine-Rich Hevein-Like Peptides from Vaccaria hispanica

Hevein and hevein-like peptides are disulfide-constrained chitin-binding cysteine-rich peptides. They are divided into three subfamilies, 6C-, 8C-, and 10C-hevein-like peptides, based on the number of cysteine residues. In addition, hevein-like peptides can exist in two forms, short and long. The lo...

Descripción completa

Detalles Bibliográficos
Autores principales: Wong, Ka H., Tan, Wei Liang, Kini, Shruthi G., Xiao, Tianshu, Serra, Aida, Sze, Sui Kwan, Tam, James P.
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Frontiers Media S.A. 2017
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5478723/
https://www.ncbi.nlm.nih.gov/pubmed/28680440
http://dx.doi.org/10.3389/fpls.2017.01100
_version_ 1783245009119608832
author Wong, Ka H.
Tan, Wei Liang
Kini, Shruthi G.
Xiao, Tianshu
Serra, Aida
Sze, Sui Kwan
Tam, James P.
author_facet Wong, Ka H.
Tan, Wei Liang
Kini, Shruthi G.
Xiao, Tianshu
Serra, Aida
Sze, Sui Kwan
Tam, James P.
author_sort Wong, Ka H.
collection PubMed
description Hevein and hevein-like peptides are disulfide-constrained chitin-binding cysteine-rich peptides. They are divided into three subfamilies, 6C-, 8C-, and 10C-hevein-like peptides, based on the number of cysteine residues. In addition, hevein-like peptides can exist in two forms, short and long. The long C-terminal form found in hevein and 10C-hevein-like peptides contain a C-terminal protein cargo. In contrast, the short form without a protein cargo is found in all three subfamilies. Here, we report the discovery and characterization of two novel glutamine-rich and protein cargo-free 8C-hevein-like peptides, vaccatides vH1 and vH2, from Vaccaria hispanica of the Caryophyllaceae family. Proteomic analyses showed that the vaccatides are 40–41 amino acids in length and contain a chitin-binding domain. NMR determination revealed that vaccatide vH2 displays a highly compact structure with a N-terminal cystine knot and an addition C-terminal disulfide bond. Stability studies showed that this compact structure renders vaccatide vH2 resistant to thermal, chemical and proteolytic degradation. The chitin-binding vH2 was shown to inhibit the mycelium growth of four phyto-pathogenic fungal strains with IC(50) values in the micromolar range. Our findings show that vaccatides represent a new family of 8C-hevein-like peptides, which are protein cargo-free and glutamine-rich, characteristics that differentiate them from the prototypic hevein and the 10C-hevein-like peptides. In summary, this study enriches the existing library of hevein-like peptides and provides insight into their molecular diversity in sequence, structure and biosynthesis. Additionally, their highly disulfide-constrained structure could be used as a scaffold for developing metabolically and orally active peptidyl therapeutics.
format Online
Article
Text
id pubmed-5478723
institution National Center for Biotechnology Information
language English
publishDate 2017
publisher Frontiers Media S.A.
record_format MEDLINE/PubMed
spelling pubmed-54787232017-07-05 Vaccatides: Antifungal Glutamine-Rich Hevein-Like Peptides from Vaccaria hispanica Wong, Ka H. Tan, Wei Liang Kini, Shruthi G. Xiao, Tianshu Serra, Aida Sze, Sui Kwan Tam, James P. Front Plant Sci Plant Science Hevein and hevein-like peptides are disulfide-constrained chitin-binding cysteine-rich peptides. They are divided into three subfamilies, 6C-, 8C-, and 10C-hevein-like peptides, based on the number of cysteine residues. In addition, hevein-like peptides can exist in two forms, short and long. The long C-terminal form found in hevein and 10C-hevein-like peptides contain a C-terminal protein cargo. In contrast, the short form without a protein cargo is found in all three subfamilies. Here, we report the discovery and characterization of two novel glutamine-rich and protein cargo-free 8C-hevein-like peptides, vaccatides vH1 and vH2, from Vaccaria hispanica of the Caryophyllaceae family. Proteomic analyses showed that the vaccatides are 40–41 amino acids in length and contain a chitin-binding domain. NMR determination revealed that vaccatide vH2 displays a highly compact structure with a N-terminal cystine knot and an addition C-terminal disulfide bond. Stability studies showed that this compact structure renders vaccatide vH2 resistant to thermal, chemical and proteolytic degradation. The chitin-binding vH2 was shown to inhibit the mycelium growth of four phyto-pathogenic fungal strains with IC(50) values in the micromolar range. Our findings show that vaccatides represent a new family of 8C-hevein-like peptides, which are protein cargo-free and glutamine-rich, characteristics that differentiate them from the prototypic hevein and the 10C-hevein-like peptides. In summary, this study enriches the existing library of hevein-like peptides and provides insight into their molecular diversity in sequence, structure and biosynthesis. Additionally, their highly disulfide-constrained structure could be used as a scaffold for developing metabolically and orally active peptidyl therapeutics. Frontiers Media S.A. 2017-06-21 /pmc/articles/PMC5478723/ /pubmed/28680440 http://dx.doi.org/10.3389/fpls.2017.01100 Text en Copyright © 2017 Wong, Tan, Kini, Xiao, Serra, Sze and Tam. http://creativecommons.org/licenses/by/4.0/ This is an open-access article distributed under the terms of the Creative Commons Attribution License (CC BY). The use, distribution or reproduction in other forums is permitted, provided the original author(s) or licensor are credited and that the original publication in this journal is cited, in accordance with accepted academic practice. No use, distribution or reproduction is permitted which does not comply with these terms.
spellingShingle Plant Science
Wong, Ka H.
Tan, Wei Liang
Kini, Shruthi G.
Xiao, Tianshu
Serra, Aida
Sze, Sui Kwan
Tam, James P.
Vaccatides: Antifungal Glutamine-Rich Hevein-Like Peptides from Vaccaria hispanica
title Vaccatides: Antifungal Glutamine-Rich Hevein-Like Peptides from Vaccaria hispanica
title_full Vaccatides: Antifungal Glutamine-Rich Hevein-Like Peptides from Vaccaria hispanica
title_fullStr Vaccatides: Antifungal Glutamine-Rich Hevein-Like Peptides from Vaccaria hispanica
title_full_unstemmed Vaccatides: Antifungal Glutamine-Rich Hevein-Like Peptides from Vaccaria hispanica
title_short Vaccatides: Antifungal Glutamine-Rich Hevein-Like Peptides from Vaccaria hispanica
title_sort vaccatides: antifungal glutamine-rich hevein-like peptides from vaccaria hispanica
topic Plant Science
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5478723/
https://www.ncbi.nlm.nih.gov/pubmed/28680440
http://dx.doi.org/10.3389/fpls.2017.01100
work_keys_str_mv AT wongkah vaccatidesantifungalglutaminerichheveinlikepeptidesfromvaccariahispanica
AT tanweiliang vaccatidesantifungalglutaminerichheveinlikepeptidesfromvaccariahispanica
AT kinishruthig vaccatidesantifungalglutaminerichheveinlikepeptidesfromvaccariahispanica
AT xiaotianshu vaccatidesantifungalglutaminerichheveinlikepeptidesfromvaccariahispanica
AT serraaida vaccatidesantifungalglutaminerichheveinlikepeptidesfromvaccariahispanica
AT szesuikwan vaccatidesantifungalglutaminerichheveinlikepeptidesfromvaccariahispanica
AT tamjamesp vaccatidesantifungalglutaminerichheveinlikepeptidesfromvaccariahispanica